KEGG   Manihot esculenta (cassava): 110628598Help
Entry
110628598         CDS       T05761                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110628598
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mesc03041]
    110628598
Enzymes [BR:mesc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110628598
Spliceosome [BR:mesc03041]
 Complex C
  Other components
   Step II factors
    110628598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD T2SSE AAA_30 AAA_19 PhoH DUF2075 DUF4606 AAA_23 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 110628598
NCBI-ProteinID: XP_021631048
Position
LG1
AA seq 726 aa AA seqDB search
MPSMAQNGPRSNLQNQKKQSNFPNKSRNSDSLARRERIKSQRLSLPIASVKERLIEEVKT
HDILIIVGETGSGKTTQLPQFLFNAGFCRDGKAIGITQPRRVAAVTVAKRVAEECGVELG
QKVGYSIRFDDKTSSSTRIKYMTDGLLLREALLDPYLSRYSVIIVDEAHERTVHTDVLLG
LLKNVQNVRSNSMKDHVNTDDKKSKNRTVQEKGTGAQCTSFLKQGHGRKFPPLKLIIMSA
SLDARVFSEYFGGARAVHIEGRQHHVDILYALHPVQDYLDATLVTIFQIHLEEAPGDILV
FLTGQEEIESIEGLVQEQLHKLPEANRKLSTVPIFSSLPSEQQMRVFMPASPGHRKVILA
TNIAETSVTIPGIKYVIDPGFVKARSYDPVKGMESLIIIPTSKAQALQRSGRAGREGPGK
CFRLYPEHEFEKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRAAIIKSLE
HLFLLGALTDDCKLSEPVGHQMARLPLDPIYSKALILASQFNCLEEMLITVAMLSVESIF
YTPREKLDEARTAAKCFSSPDGDHLTLVNVYRAVDGLLEKRKMEFGNEKSLKGKNEKFLR
KWCKENFINGRSLRHARDIHSQIRGHVEQMGLRISSCGDDVLQFRRCLAASFFLNAALKQ
PEGTYRALASGQVVQIHPSSVLFQSKAECVIFNELVQTTKKYIRNVTRIDYLWLTELAPH
YYASQS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatggcgcagaacggacccagaagcaatcttcaaaaccaaaagaagcagtcc
aacttccccaataagtctcgcaattctgattctttggccaggagagagaggattaagagt
cagaggttgtctctacctatagcttcagttaaggaacgacttattgaggaggttaaaacc
catgatatattgatcattgttggtgaaactggaagtggaaaaacaactcaattacctcag
tttctgttcaacgctgggttttgtcgagatggaaaagctattgggataacgcaacctagg
cgtgttgcggcggtcactgtggcaaaacgggtggcagaggaatgcggcgttgagctggga
caaaaggttggatattccatcaggtttgatgacaaaacctctagctctacaaggattaag
tacatgactgatggattgctactcagggaagcattactggatccttacctctctagatat
tcagtcatcattgttgatgaagctcatgagagaactgtccacactgatgttctgctggga
ttgctaaaaaatgtacaaaatgttaggtcaaactctatgaaggaccatgtcaatacggat
gacaagaagtcaaagaacaggacagtgcaggagaaaggaactggtgctcaatgtactagt
tttctcaagcaaggccatggcaggaaattccctccactgaagttaatcataatgtctgcc
agcttggatgctcgtgttttttctgagtattttggtggtgccagagctgttcatattgaa
gggcgccaacatcatgttgatatactgtatgctcttcatcctgtgcaagattatcttgat
gcgaccttggttactatattccagattcatttggaggaggcccctggtgacatacttgta
tttctaactggccaagaagagattgagtccattgaaggacttgtgcaggaacaacttcat
aaattacctgaagccaatagaaagttgtcaactgttcctatattttcatctcttccatcg
gagcagcagatgcgggtcttcatgccagcttcacctgggcatcgtaaggtaatattggca
acaaatattgctgagacatctgtgacaatacctggaatcaaatatgttatagacccagga
tttgtgaaagcacgttcttatgatccagtcaaagggatggaatcattgataattattcca
acttcaaaagctcaggcacttcaaaggagtggacgtgcaggtcgcgaaggacctggaaag
tgctttcgtctgtatccagagcatgaatttgagaaacttgaggattcgacgaagccagag
atcaagcggtgcaacctctcaaatgtcatcttgcagctgaaggctctgggtgtcgacgat
atcattgggtttgatttcatggaaaagccatctagggcagctatcatcaaatcattggag
catctgtttttgcttggtgctttgacagatgactgtaagttgtcagaacctgttgggcat
caaatggctcggcttcctttagatcctatttattccaaagctctcatcttagctagtcag
ttcaactgcttggaagaaatgctgataactgttgcgatgctctcagtggaatctattttt
tatacccctcgtgagaaattggatgaggcgagaactgcagcgaagtgcttttcaagtcca
gatggagaccatcttactttggttaatgtgtatcgggcagtagatggacttttggaaaag
agaaagatggaatttggtaatgaaaaaagtctcaaaggaaaaaatgaaaaatttctgaga
aaatggtgcaaggaaaatttcattaatggccgttcactgaggcatgctcgtgacattcac
agtcaaattcgaggacatgttgaacaaatgggtcttcgtatttcttcatgtggagatgat
gtgcttcaatttcgaagatgccttgctgcttcctttttccttaatgcagctttgaagcag
cctgaggggacgtacagggccttggcaagtggacaggtagtgcagatacacccttcttct
gtgttattccagtcaaaggcagaatgcgtaattttcaatgaactggtccaaaccactaag
aagtacatccgcaacgtaactaggatcgattatttatggttaactgagcttgctcctcac
tactatgcctcacagagttaa

DBGET integrated database retrieval system