KEGG   Manihot esculenta (cassava): 110629899Help
Entry
110629899         CDS       T05761                                 

Definition
(RefSeq) serine/threonine receptor-like kinase NFP
Organism
mesc  Manihot esculenta (cassava)
Brite
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110629899
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110629899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 110629899
NCBI-ProteinID: XP_021632792
Position
LG13
AA seq 620 aa AA seqDB search
MAVPLLSFPSLQVLFLLLLFVSAACITAQSPEGTNFTCSVDETSPCETYVAYLAQSPNFL
NLGNISDLFAVSRLAIASASNLVSEDTSLIPDQLLLVPVNCGCTGNHFFARITYQIKHGD
NYYLVSTTSFENLTNWEAVKVLNPKLDPNLLHPGDKVIFPLFCKCPSKTHLKNGIQYLIT
YVWQPDDDVFNVAAKLNASPHDIAIENNYRDFSVAVHHPLLIPVTQLPVLSQPSPFLPQR
RKHHGIIIVVASITGVLLIFLLLYFLVHVHCSGNKKKKNMALCRSGSFLESADLLQRKEL
KKYESSEPKIIQGKLLPGVSGYLGKPIMYDVKEIMKATMDLHEHYRIGGSVYRANINGQV
LAVKKTKEDVTEELKILQKVNHANLVKLIGLSSDTDGSCFLVYEYAENGSLDKWLHLKSA
SSSISVAFLSWSQRLHIALDVASGLQYMHEHIQPSIVHMDIRTSNVLLDTRFKAKIANFS
MAKLAKESLLPKVDVFAFGIVLLELLSGKKAMVTKENGEISLLWKEMKGVMEVAEKREER
LRKWMDPNLENFYPIDGALSLVNLARACTMEKSSARPSMAEIVFNLTVLTQSSSDTLERS
WTSGLEAEEDIQITSPVTAR
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcctctcttatctttcccttcattgcaagttctttttctcttgcttctcttc
gtttctgccgcctgtatcacagcacaatcacctgaaggcacaaattttacatgttctgtg
gatgaaacttccccttgtgaaacttacgttgcttatcttgcccagtcaccgaacttcctg
aatcttgggaacatatctgatttgtttgcagtcagtcgtctggcaatagcaagtgccagc
aatttggtgtccgaggacacctctttaattccagaccagctcttacttgtgcctgtaaat
tgtggctgcacagggaaccatttttttgccaggattacttaccagatcaagcatggtgat
aactactacttggtttcgaccacttcgtttgagaatcttactaattgggaggctgtgaaa
gttcttaaccccaaattggatccgaacctcttgcatcctggtgacaaagtgatttttcct
ttgttctgtaagtgcccatcaaagactcatttgaagaatggaattcaatatcttattact
tatgtgtggcagcctgatgatgatgtcttcaatgtggctgctaagctaaatgcgtctcca
catgatattgctatagaaaacaactatagagactttagtgttgcagtgcatcatccactg
ctgatcccagtgactcaattgccggttctgtctcaaccatctccctttctacctcaaaga
agaaagcatcacgggatcatcatagtagttgcaagcataactggtgtccttttgatcttc
cttcttctatattttctggttcatgttcattgttcaggtaacaagaagaagaagaacatg
gctttgtgtcgtagtggttcctttttggagtccgcggatcttcttcaaaggaaagagctc
aagaaatatgagagttccgaacctaagatcatacaaggtaagcttcttcctggggtttca
ggctatttaggcaagccaatcatgtacgatgtcaaggagattatgaaggcaaccatggat
ctacatgaacattacaggatcggaggatcagtatatagagcgaacatcaatggtcaggtc
ctagcagtaaagaaaacaaaggaagacgtcacagaagaactaaagattctgcagaaagtg
aatcatgcaaatctagtgaaattaattggactttcatccgacacagatgggagttgcttc
ttagtttatgaatatgcagaaaatgggtcactggacaagtggttgcacctaaaatcggca
tcttcctcgatctcagtggcctttctctcctggagtcagaggttacatatagcactagat
gtagccagtgggctgcaatacatgcatgaacatattcaaccaagcattgttcacatggat
ataagaacaagtaatgtacttcttgacaccagatttaaggcaaagatagcaaatttctcg
atggctaaacttgccaaagaatctctgctgccaaaagtagatgtttttgcttttgggatt
gttctgttggaattgctttcaggaaagaaagccatggtaacaaaagaaaacggcgagatt
tccttgttgtggaaggagatgaaaggcgtcatggaagttgcagagaaaagagaggagagg
ttaaggaagtggatggatccaaacttggagaacttctatccaatagatggtgctctaagt
ttggtaaacttggcaagggcatgcactatggagaagtcttcagcaaggccaagcatggca
gaaattgtcttcaacctcactgttctcacacagtcatcttcagatacattagaaaggtca
tggacttctgggcttgaagcagaagaagatattcagataaccagtccagtcacagctcgt
tga

DBGET integrated database retrieval system