KEGG   Manihot esculenta (cassava): 110629933Help
Entry
110629933         CDS       T05761                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mesc  Manihot esculenta (cassava)
Pathway
mesc00450  Selenocompound metabolism
mesc00970  Aminoacyl-tRNA biosynthesis
mesc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110629933
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110629933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mesc01007]
    110629933
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mesc03016]
    110629933
Enzymes [BR:mesc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110629933
Amino acid related enzymes [BR:mesc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110629933
Transfer RNA biogenesis [BR:mesc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110629933
 Prokaryotic type
   Other AARSs
    110629933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e DUF3847 Hormone_recep CLIP1_ZNF
Motif
Other DBs
NCBI-GeneID: 110629933
NCBI-ProteinID: XP_021632841
Position
LG13
AA seq 618 aa AA seqDB search
MEDREGSKNLPKLPIPGKRNILTTSALPYVNNVPHLGNIIGSVLSADVFARYCRLQGYNV
IFICGTDEYGTATETKAMEENCTPQEICDKYHAIHKAVYDWFDISFDEFGRTSTPQQTEI
CQAIFKKLMENNWLSENTMQQLYCDTCERFLADRFVEGTCPTPGCDYNSARGDQCEKCGK
LLNPTELKDPRCKVCQTTPRICDTDHLFLELPLLKDKLKNYIDETSVIGSWSQNAIQATY
AWLRDGLKPRCITRDLKWGVPVPLEKFKDKVFYVWFDAPIGYISITACYSPDWEKWWKNP
EHVELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKSISVTEYLNYESGKFSKSKGIGVF
GNDAQDTEQPAEVWRYYLLANRPEISDTIFTWEDFQAKLNSELINNLGNFIHRVLSFIAN
TSGKGYETIIPDAPGADSHVLTVALAEKVGYHVDQYVKSMEQVKLKQGLKCAMNISGEGN
AYLQESQYFRMFEEDQASCSIVVKTSVGLVYLLACLLEPFMPSFSHKVFKLLKLPPETTF
SLSEKKDLERAQKPWELIPAGHKIEKPYPLFKKLTDDEVKVFKAKFAGSRGADREKIEAE
AKKMAEKLKKTHISESKN
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggaagatcgagaaggaagcaaaaatttgccgaagctgcctataccagggaaaagaaac
atactcaccacaagcgccttgccttatgtcaataacgttcctcaccttggcaatattatt
ggcagtgttttaagtgctgatgtttttgctcgttattgccgtctccaaggctacaatgtt
atattcatatgtggaactgatgaatatgggacagctactgagactaaagctatggaggaa
aactgtacccctcaggaaatttgtgacaaatatcatgcaattcataaagcagtctatgac
tggtttgatataagttttgatgagtttgggcgcacgtcaactcctcagcaaactgagatt
tgccaagcaattttcaagaagctgatggagaacaattggctttctgagaacacaatgcag
cagctttactgcgatacatgtgagcgtttcctagcagaccggtttgttgaaggcacctgc
ccaacaccagggtgcgattataattctgcacggggggatcaatgtgaaaagtgtggaaaa
cttttgaatccaacagaacttaaagatccgaggtgcaaagtatgtcagacaactccaagg
atttgtgacactgaccatttgtttctagagctcccattactgaaggataaattgaaaaac
tatattgatgagacttcagtaataggatcttggagccaaaatgctattcaagctacatat
gcatggcttagagatggacttaaacctcgctgcattactcgggatcttaagtggggggtt
cctgttccacttgaaaaattcaaagataaggtcttctatgtttggtttgatgcacctatt
ggatatatatctattactgcatgctattcacctgactgggagaagtggtggaagaaccct
gaacatgtggagctctatcagtttatgggcaaggataatgtgccgttccatactgtcatg
tttccctctacacttctcggtactggagaaaactggactttgatgaaaagcattagcgtt
acagaatatctaaactatgaatcaggaaaattctccaagagcaagggcataggagttttt
ggcaatgatgcgcaagatacagagcagcctgctgaagtctggcgatactatttgctggca
aaccggccagagatctcagacacgatatttacatgggaggactttcaagcaaagttaaat
tccgagttgataaataatttaggcaattttatacatcgagtattgagcttcattgccaac
acttcaggaaaaggatatgaaactatcattcctgatgctccaggggcagattcacatgtc
ttgacagtagcattggcagaaaaagttggttaccatgtggatcaatatgtaaaatccatg
gagcaggttaagctaaaacaaggattgaaatgtgcaatgaacatttctggtgaagggaac
gcgtatctgcaagagagccaatattttaggatgttcgaggaagatcaagcttcctgctct
attgttgtgaaaacttctgtggggcttgtctatcttcttgcatgtttattagaacctttc
atgccatcattttcccataaggtgttcaagttgcttaagctgcctcctgaaacaacattt
tcactgtctgaaaagaaagatcttgagagggcacaaaagccctgggaacttattcctgct
ggtcataaaatagagaagccatatccgttattcaagaaactgacagatgatgaggtgaaa
gtcttcaaggccaagtttgctggaagtcggggagctgatagagaaaagatagaggcagaa
gctaagaagatggctgagaaattgaagaaaacacatatttctgaatccaaaaactga

DBGET integrated database retrieval system