KEGG   Manihot esculenta (cassava): 110630723Help
Entry
110630723         CDS       T05761                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mesc01001]
    110630723
Enzymes [BR:mesc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110630723
Protein kinases [BR:mesc01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110630723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind WAK_assoc APH
Motif
Other DBs
NCBI-GeneID: 110630723
NCBI-ProteinID: XP_021633968
Position
LG14
AA seq 641 aa AA seqDB search
MKTHLNFLSLTMKKQESPTISTLLVLSLFIFLSTIEVEARVLQQICSSSCGDLTNITYPF
RLTTDPVKCGDPDYQISCQDNKPILEFHSGKYFVKQISYDRHIIRLVDINLANGSCNLPY
KSVSINEVKYDSRYRGLVSSTFASFFRCSSEINDPAYRKVPCLSGNGSHFYVSYGTYIIS
DLQGYCSFTSRVPTIYQAVWYPSYESILELMALGFDLEWSVECRDCIADGGSCSLSSLGT
PNIYECHFSGIHVPPLVSSIIYAIWDILLGINLIARFILAPIVIVGFLIYRHRTAKKAED
NKENFLPSQRSLMPRRYSYSDLIAITDNFKDKLGQGGFGTVYKGQLPDGFSVAVKMLGNS
KCSDVDFINEVFTIGKIHHAHVIQLVGFCCDGSYRALLFEYMVNRSLDKYIFAGETELQP
LSWERLLRIAVGTAQGIEHLHTGCDVCILHFDIKPHNVLLDHNFIPKVSDFGLAKFYPKE
YDFVLVSTARGTMGYIAPELMSNNLGAVSCKSDVYSFGMLLLEMARGRRNTDAKGNSSSK
VYFPSWVYDRLNGEGDLELDNVSETEAAIAKKLCVVGLWCIQENASDRPLMAKVVEMLSS
SIDDMQLPPSPLSFPDHIAVEEPQSDSSTELLISETVEHSV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcatctgaatttcttatccttaactatgaaaaagcaagagtcaccgacgatt
tccactcttcttgtgctttccctcttcatctttctatctacaattgaagttgaagcaaga
gttctccaacaaatttgctcttcctcgtgtggtgatctcaccaacatcacttacccattt
cgcctaaccaccgatccagtcaagtgtggagatccagactatcaaatttcttgccaggac
aacaaacccattttggaatttcactcagggaagtatttcgtcaagcaaatttcctatgac
aggcatataatccgactggttgatattaacttagccaatggtagctgcaacctgccgtac
aagtcagtatcaattaatgaggtaaagtatgatagtcgctataggggattggtatctagt
acgtttgccagtttcttcagatgttcaagcgagatcaatgatccagcttataggaaagtt
ccttgtttgagcggaaatggttctcatttttatgttagttatggcacatatataatatct
gatcttcaaggttactgttccttcacttcgagggttcccacaatttaccaggctgtatgg
tacccttcttatgaaagtatcttggaattgatggcgttagggtttgatcttgaatggtct
gttgagtgccgggattgcattgcagacggtggttcctgcagtttgagctcattgggtaca
ccaaatatctatgaatgccacttttcaggcatacatgtaccccctctggtttcaagtatc
atttatgctatttgggatattttgttaggcataaatctgattgcgagattcatccttgct
ccaatagttatagttggattcctaatttacagacacagaacagcaaagaaggctgaagat
aacaaggagaactttctaccgagtcaacgatccttgatgcccagaaggtactcttactct
gatttgattgcaattacagacaatttcaaagataaattaggccaaggtggctttgggaca
gtgtacaaaggacaacttcctgatggcttttcagttgctgttaaaatgctcggcaactcc
aagtgcagtgatgtagacttcattaatgaagtcttcacaattggtaaaattcatcatgct
catgtaatacagttggtgggattctgttgcgatggatcttatcgtgctcttctctttgag
tatatggttaataggtctcttgataagtacatatttgctggagaaacagaacttcagcca
ttgagttgggagagacttcttcgaattgctgtagggacagcacaaggaattgagcaccta
catacaggatgtgatgtgtgcattcttcattttgatatcaagcctcataatgtcctgctt
gaccataacttcatccctaaagtttccgattttggtcttgcaaaattttaccccaaagaa
tatgattttgtgttggtcagtactgcaagaggaactatggggtacattgctcctgagttg
atgtcaaacaaccttggagctgtttcttgcaaatcagatgtctatagttttggaatgtta
ttgttggaaatggctcgaggaagaaggaacactgatgcaaagggaaatagttcaagcaaa
gtatatttcccatcgtgggtttatgaccgtctaaacggggaaggagatttagagcttgac
aatgttagtgagaccgaggctgcaatagcaaaaaaattatgtgtagtcgggttatggtgc
atccaagagaatgcatctgatcggccattgatggccaaagttgtggaaatgttaagtagt
agcattgatgatatgcaactgcctcctagtcctttgtctttccctgatcacattgctgtg
gaagagcctcaatcagattcttcgacagagttgctgatatctgaaacagtggagcacagc
gtgtag

DBGET integrated database retrieval system