KEGG   Manihot esculenta (cassava): 110630742Help
Entry
110630742         CDS       T05761                                 

Definition
(RefSeq) probable glycosyltransferase At5g20260
  KO
K18789  xylogalacturonan beta-1,3-xylosyltransferase [EC:2.4.2.41]
Organism
mesc  Manihot esculenta (cassava)
Brite
KEGG Orthology (KO) [BR:mesc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mesc01003]
    110630742
Enzymes [BR:mesc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.41  xylogalacturonan beta-1,3-xylosyltransferase
     110630742
Glycosyltransferases [BR:mesc01003]
 Polysaccharide
  Structural polysaccharide
   110630742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Orbi_VP4
Motif
Other DBs
NCBI-GeneID: 110630742
NCBI-ProteinID: XP_021633993
Position
LG14
AA seq 384 aa AA seqDB search
MEDCLARSRAAIREAVRTQKCSSCKEKTFVPRGAIYRNSYAFHQSYIEMEKRFRVWVYKE
GEPPLVHIGPVIDIYGIEGQFIDEMESGKSHFLARNPDEANVFFIPISITNIISYVYNPL
VTFSRAQLQNIVTDYIGVISDKYPFWNRSNGADHFLISCHDWAPDVSKANPELYKNFIHV
LCNANYSEMYQPQRDISMPEIKIPPGKLLGTSPRDGQPPSKRTILAFFAGGSHGYIRKVL
LNHWKDKDDEIQVHEYLDKKKNYFKLMGRSKFCLCPSGYEVASPRVVTAIQLGCVPVIMS
ENYTLPFSDVLDWSKFTVRIPLEKIAEIKTILKRISQRRYLQLQRRVMLVRKHFVVNRPA
QPYDMIDMVLHSLWLRRLNLRLPY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaagattgtttggctagatcaagagccgccattcgtgaagcagtgagaacccagaag
tgttcttcttgcaaggagaagactttcgttccaagaggcgccatctacagaaattcttac
gcttttcatcagagttatattgagatggagaagagattcagggtgtgggtttacaaggaa
ggggagccaccgttagtacacatcggccctgtaattgacatctacggcatcgaaggtcag
ttcatcgatgaaatggagagcggcaagagccacttcctcgctcgcaatcctgacgaagct
aacgtattcttcatccccatcagcatcaccaatatcatcagctacgtttacaatcctctc
gtcaccttctctcgcgcgcagcttcaaaacatcgtcactgattacatcggcgtcatctcc
gataaataccctttctggaatagaagcaacggagcagaccatttcttgatctcttgccat
gattgggcaccagatgtctctaaagccaatcccgagctttacaagaatttcattcacgtc
ctttgtaatgcaaattattcagaaatgtaccagcctcaaagagacatctccatgccagaa
atcaaaatcccaccaggcaaactactcggcacttcccctcgtgacggccaacctccaagc
aagcgtacaatcctcgccttcttcgccggaggatcccatggttacattagaaaagtcctc
ttaaatcactggaaagacaaagacgacgagattcaagttcacgaatacctcgacaagaaa
aaaaactactttaaactaatgggtcgaagcaagttctgtctgtgtccaagtgggtacgaa
gtagcaagtcctagagttgtaacagcaattcaactaggatgtgtcccagtgataatgtct
gaaaactatacgctgccgtttagtgatgtgcttgactggagcaagttcacagttcggatt
ccattggagaagatagctgaaatcaagacaattttgaaaaggatctcgcagagaaggtat
cttcaattgcagagaagagtgatgctggttcgcaagcattttgtggtgaatagacctgcg
cagccatatgacatgattgatatggtgctccactctctgtggttaaggaggcttaatttg
agacttccatattaa

DBGET integrated database retrieval system