KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_08590Help
Entry
EJ066_08590       CDS       T05904                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00360  Phenylalanine metabolism
mesm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mesm00790  Folate biosynthesis
mesm01100  Metabolic pathways
mesm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    EJ066_08590 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EJ066_08590 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EJ066_08590 (phhA)
Enzymes [BR:mesm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     EJ066_08590 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H DUF3693
Motif
Other DBs
NCBI-ProteinID: AZN97342
UniProt: A0A3Q8XUG9
Position
complement(1713389..1714225)
Genome map
AA seq 278 aa AA seqDB search
MTINVAEYARECAAQGLRGDYSVCRADFTVAQHYDYSAEEQAVWRTLCDRQTKLTQKLAH
QSYLDGVAALGLLDKIPDFGSVSEKLRKLTGWEIVAVPGLIPAAPFFVHLASRRFPVTNW
LRTRQELDYIVEPDMFHDFFGHVPALAQPVFADFMQMYGEKAEHLIALGGDEMISRLYWY
TVEYGLIQEAGQPLKAFGAGLMSSFAELQFAIEGKDAHHVPFDLETVMRTSYEIDKFQRA
YFVLPSFDVLRDAFQNVAGLAAIVGRHKGKPALDPAKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaacgttgccgagtacgcaagggaatgcgcggcgcaaggccttcgcggcgac
tattcggtctgccgtgccgacttcaccgtggcgcagcattacgattacagcgctgaagag
caggccgtatggcgcacgctgtgcgaccgccagacaaagctgacgcagaagctggcgcat
cagtcctatctcgacggcgtcgccgcgcttggccttctcgacaagatcccggatttcggc
tcggtcagcgaaaagctgcgcaagctcaccggctgggagatcgtcgccgtgccgggcctt
atccccgccgcgccgttcttcgtccatctcgccagtcgccgctttccagtcaccaactgg
ctgcggacgcggcaggagctcgactacatcgtcgagccggatatgttccacgacttcttc
ggccatgtgccggcgcttgcccagccggtctttgccgacttcatgcagatgtatggcgaa
aaggccgagcatctgatcgcgcttggcggcgacgagatgatcagccgcctctactggtac
actgtcgaatacgggctgatccaggaagcaggccaaccgttgaaggctttcggcgccgga
ctgatgtcatcgtttgcggaacttcagttcgcgatcgaaggcaaggatgcgcaccatgtc
cccttcgatctggaaacggtcatgcgcaccagctacgagatcgacaagttccagcgcgcc
tattttgtactgccgtccttcgacgtcttgcgcgatgccttccagaacgtcgccggcctg
gcagcgatcgtcggacgccacaagggcaagccggcgctcgaccctgcgaaactttag

DBGET integrated database retrieval system