KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_24880Help
Entry
EJ066_24880       CDS       T05904                                 

Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EJ066_24880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mesm01007]
    EJ066_24880
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mesm03016]
    EJ066_24880
   03029 Mitochondrial biogenesis [BR:mesm03029]
    EJ066_24880
Enzymes [BR:mesm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     EJ066_24880
Amino acid related enzymes [BR:mesm01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   EJ066_24880
Transfer RNA biogenesis [BR:mesm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EJ066_24880
 Prokaryotic Type
   Other AARSs
    EJ066_24880
Mitochondrial biogenesis [BR:mesm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EJ066_24880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1e tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZO00099
UniProt: A0A3S9BMY8
Position
complement(5131229..5132986)
Genome map
AA seq 585 aa AA seqDB search
MNIFADFTARIIRAVEALDLKDKDGGSLDLSRIAVEPPRDASHGDLATNAAMVLAKPTGQ
NPRALAERLAQALRADSDIAAADIAGPGFVNLRLKDAFWQAHLTALLGEGRNYGRSTVGG
GRKANVEYVSANPTGPMHVGHCRGAVVGDALANLMAFAGYDVTKEYVINDAGTQIDVLGR
SVMLRYREALGDDIGEIPAGLYPGDYLIPVGQALAGEFGRSLLQMPDEEALAIVKDRSID
AMMAMIRADLALLNVHHDVFFSERTLHADNARKIRSAIADLTLKGHIYKGKLPPPKGEKP
DDWEDREQTLFRSTAVGDDMDRALVKSDGTFTYFAADVAYLKDKVGRGFVELIYVLGADH
GGYVKRLEALARAIAGDEVKLTVLLCQLVKLFRDGEPVRMSKRSGDFVTLREVVEEVGRD
PIRFMMLYRKNDAPLDFDFAKVTEQSKDNPVFYVQYASARCHSVFRQASEQLGEANFDRN
RLAAATASLTDEGEIGLIRKLAEYPRLIESAALALEPHRLAFYLYDLASSFHGHWNRGTE
NPDLRFVKVNDRQLTHARLGLVQAVSDVLTSGLTLIGADAPTEMR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcttcgccgatttcaccgcgcgaatcatcagagctgtcgaagcgcttgatttg
aaagacaaggacggcggttcgctggacctgtcgcgcatcgccgtcgagccgccgcgcgac
gccagtcatggcgacctggcgaccaatgcggcgatggtgctggccaagccgacaggccag
aatccacgcgcactggccgaaaggctggcgcaggcgctgcgcgccgacagcgacatcgcc
gccgccgacattgccggtccgggcttcgtcaatctcaggctcaaggacgcattctggcag
gcgcatctgaccgcgctgctcggcgagggccgcaattatggccgctcgacggtcggcggc
ggcaggaaggccaatgtcgaatatgtctcggccaacccaaccgggccgatgcatgtcggt
cattgccgtggcgccgtggtaggtgacgcgctcgccaatctgatggccttcgccggctac
gacgtgaccaaggaatatgtcatcaacgatgccggcacgcagatcgacgtgctcggccga
tcggtcatgctgcgctaccgcgaggcgctcggcgacgacatcggcgaaataccggccggg
ctttatccgggcgattatctgatcccggttggccaggcgttggccggcgaattcggccgc
tccttgctgcagatgcccgacgaggaagcgcttgccatcgtcaaggaccggtcgatcgac
gcgatgatggcgatgatccgcgcggatctggcgctgctcaacgttcatcacgacgtcttt
ttctcggagcgcacgctgcatgccgacaacgcccgaaaaatccgctcggccatcgccgac
ctgacgctcaaggggcatatctacaagggcaagctgccgccgcccaagggcgagaagccg
gacgactgggaggatcgcgagcagacgctgttccgctcgacggcggtcggcgacgacatg
gaccgggcgctggtcaagtcggacggcaccttcacctatttcgccgcggacgtcgcctat
ttgaaggacaaggtcggccgcggcttcgtcgagctgatctatgtgcttggcgccgatcat
ggcggctatgtgaagcgcctggaagcgctcgcccgggcgatcgccggcgacgaggtgaag
ctcaccgtactgctttgccagttggtgaagctttttcgcgacggcgagccggtgcgcatg
tcgaagcggtcgggcgatttcgtgaccctgcgcgaagtggtggaggaggtcggccgcgat
ccgatccgtttcatgatgctctaccgcaagaacgatgcgccgctcgatttcgacttcgcc
aaggtgactgagcagtcgaaggacaatccggtgttctacgtccagtacgcttcggcgcgc
tgccattcggtgttccgccaagccagcgagcagttgggcgaggccaatttcgaccgcaat
cggctggcggcagccaccgcttcgctgaccgacgaaggcgagatcggcctgatccggaag
ctcgcggaatatccgcggctgatcgaatccgcggcacttgcgctcgagccgcaccggctg
gcattctacctctatgatctcgcctccagcttccacggacattggaaccgcggcaccgag
aatcccgacttacgttttgttaaggttaacgaccgacaattgacgcatgccagactaggg
ctggtgcaggctgtttcggacgttttgacgtccggcctgacgctgatcggagcggatgcg
cccaccgaaatgcgttag

DBGET integrated database retrieval system