KEGG   Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2: EJ066_26490Help
Entry
EJ066_26490       CDS       T05904                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mesm  Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2
Pathway
mesm00670  One carbon pool by folate
mesm00790  Folate biosynthesis
mesm01100  Metabolic pathways
Module
mesm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mesm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EJ066_26490
   00670 One carbon pool by folate
    EJ066_26490
Enzymes [BR:mesm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EJ066_26490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AZO00388
UniProt: A0A3Q8XZF4
Position
complement(5459130..5459648)
Genome map
AA seq 172 aa AA seqDB search
MDVAIYVAIAENGVIGRDGGLPWRLSSDLKRFKADTMGKPIIMGRKTYDGIGRPLPGRLN
IVVTRDKAWRAEGVEIVHSLDEAIRLAKVRGRCMAGADEICVIGGGEIYTQALPLADRLH
VTHILGPVDGDAHFPPIDPDLWRMVRSQEVPAGEKDSHATRYSVYERRGGVH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgcgatctatgtcgccatcgccgaaaacggcgtgatcgggcgcgatggcggg
ttgccgtggcggctttccagcgacctcaagcgcttcaaggccgacacgatgggcaaacct
atcatcatgggccgcaagacctatgatggtatcggccgacctctgccggggaggctcaac
atcgtggtgacccgcgacaaggcctggcgcgccgagggcgtcgagatcgtgcattcgctt
gacgaggcgatcaggctggcgaaggtgcgcgggcgctgtatggccggcgccgacgaaatc
tgcgtcatcggcggcggcgagatctatactcaggcgctgccgctggccgaccgtttgcac
gtcacccatatccttggcccggtcgacggcgacgcgcatttcccgccgatcgacccggat
ttgtggcgcatggtccgctcgcaagaggttccggccggcgagaaggatagccatgcgaca
cgctattcggtttacgagcgacgcggcggcgtgcattga

DBGET integrated database retrieval system