KEGG   Mesorhizobium sp. B7: BSQ44_07465Help
Entry
BSQ44_07465       CDS       T04603                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00361  Chlorocyclohexane and chlorobenzene degradation
meso00625  Chloroalkane and chloroalkene degradation
meso01100  Metabolic pathways
meso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSQ44_07465
   00361 Chlorocyclohexane and chlorobenzene degradation
    BSQ44_07465
Enzymes [BR:meso01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BSQ44_07465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: APH71230
UniProt: A0A1L3SPC6
Position
complement(1488544..1489170)
Genome map
AA seq 208 aa AA seqDB search
MPEIRHIVFDIGRVLIHYDPNLPFSRVIPDEAKREWFFANVCTSDWNLEQDRGRSWEEAE
ALLIAQHPDEEENIRAFRRFWHEMVPHAYDGSVEIMLGLIEAGRDVTMLTNFATDTFAEA
QARFPFLTRPRGVTVSGEVKLIKPDRAIYDLHAESFGLDPAGSLFIDDSPKNVEGAKAAG
WQAVLFTDPDTLRRDLGRAGVWPVAARN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatccgccatatcgtgttcgacatcggccgggtgctgatccactacgatccg
aacctgccgttcagccgcgttatccccgacgaggcgaagagggagtggttcttcgccaac
gtctgcacgtcggactggaaccttgagcaggaccgcggccgcagttgggaggaggccgag
gcgctgttgatcgcgcagcatccggacgaagaggagaacatccgtgccttccggcgcttc
tggcacgagatggtgccgcacgcctatgacgggtcggtggagatcatgctgggcctgatc
gaggccggccgcgacgtgaccatgctgaccaacttcgccaccgacacctttgcggaggcg
caggcgcggtttcccttcctgacgcggccgcgcggcgtgacggtctcgggcgaggtgaag
ctgatcaagcctgaccgggcgatctacgaccttcacgccgagagtttcgggctcgacccg
gcggggtcgctgttcatcgacgacagcccgaagaacgtcgagggcgccaaggcggccggc
tggcaggcggtgctgttcaccgatcccgacacgctgaggcgcgatctcgggcgggccggc
gtatggccggtcgccgcgcgaaattga

DBGET integrated database retrieval system