KEGG   Mesorhizobium sp. B7: BSQ44_14710Help
Entry
BSQ44_14710       CDS       T04603                                 

Definition
(GenBank) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00860  Porphyrin and chlorophyll metabolism
meso00970  Aminoacyl-tRNA biosynthesis
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSQ44_14710
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSQ44_14710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:meso01007]
    BSQ44_14710
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:meso03016]
    BSQ44_14710
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:meso02048]
    BSQ44_14710
Enzymes [BR:meso01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BSQ44_14710
Amino acid related enzymes [BR:meso01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BSQ44_14710
Transfer RNA biogenesis [BR:meso03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSQ44_14710
 Prokaryotic Type
   Other AARSs
    BSQ44_14710
Prokaryotic defense system [BR:meso02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BSQ44_14710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: APH72470
UniProt: A0A1L3SSW8
Position
3016721..3018142
Genome map
AA seq 473 aa AA seqDB search
MPAPVVTRFAPSPTGYLHIGGARTALFNWLFSRHTGGKMLLRIEDTDRERSTEAATAAIL
DGLSWLGLAWDGEPVSQFARAERHREIGEELVRRGKAYRCYASQAELEEMREKARAEGRP
PRYDGRWRDRDSAEAPAGVRPVIRIKAPQEGETVVHDKVQGDVRFPNKDLDDFIILRSDG
NPTYMHAVVVDDHDMGVTHIIRGDDHLTNAARQTIIYQAMDWDVPVMAHIPLIHGADGAK
LSKRHGALGVEAYRAMGYLPEALRNYLARLGWSHGDDEVMSTEEMIGWFEIEDVNKGAAR
FDFQKLEALNGMHMRRTPDAELLDNLLATLPYIEGGKAMADKLDDRRKAMLLQAMPGLKE
RAKTLVELADSAGYLFSERPLTLDEKAEKLVGEPPREILAGAKAALENITGEWNAETTEA
AIRAYVAETGLKLGAVAQPLRAALTGRSTSPGVFDVLAVLGREESLGRLGDLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacccgtcgtcacgcgcttcgcgccgtcccccaccggttacctccacatcggc
ggcgcgcgcaccgcgctcttcaactggctcttctcccggcacacgggcggcaagatgctg
ctgcggatcgaggacactgatcgcgagcgctcgaccgaagcggcgaccgcggcgatcctc
gacggtctttcctggctcggcctcgcctgggacggcgaacccgtctcgcaattcgcgcgc
gccgagcgccatcgagagatcggcgaggaactcgtccggcgcggcaaggcctatcgctgc
tatgcgtcccaggccgaactggaggaaatgcgcgagaaggcgcgcgcagaaggacgccct
ccccgctacgacggccgctggcgcgaccgcgattcggccgaggcgccggccggcgtcagg
ccggtcatccgcatcaaggcgccccaagaaggcgagaccgtcgtgcacgacaaggtgcag
ggcgacgtccgttttcccaacaaggacctcgacgacttcatcattctgcgctcggacggc
aacccgacctacatgcacgccgtcgtggtcgacgatcatgacatgggcgtcacacacatc
atccgcggcgacgatcatctgaccaatgctgcgcgtcagacgatcatctatcaggcgatg
gattgggacgtaccggtgatggcccacattccgctcatccacggagcggacggcgcgaag
ctgtcgaagcggcacggagcgctcggcgtcgaggcctaccgggccatgggctacctgccg
gaagcgctgcgcaactatctggcgcggctcggctggagccacggcgacgacgaggtgatg
tcgacggaagagatgatcggctggttcgagatcgaggacgtgaacaagggcgccgcgcgc
ttcgatttccagaaactggaagccctgaacggcatgcacatgcgccgcacgccggatgcc
gaactcctcgacaaccttctcgcgacgctgccctatatcgagggcggcaaggcgatggcc
gacaagctcgacgacaggcgcaaggccatgctgcttcaggccatgccaggtctgaaggag
cgtgcgaagacgctggtggaactggccgacagcgccggctatctgttctccgaaaggccg
ctgaccctggacgagaaggcggaaaagctggtcggggagcctccgcgcgagattctcgcg
ggcgcgaaggcggccctcgagaacatcacgggcgaatggaatgcggagacgaccgaagcc
gcgatccgcgcctacgtcgccgaaaccgggctcaagctcggcgcggtggcgcagcccctg
cgtgcagctctcaccggccgttcgacgtcgcccggcgtcttcgacgtgctcgcggtgctc
ggacgcgaggagagcctcggccgcctcggcgacctgctgtga

DBGET integrated database retrieval system