KEGG   Mesorhizobium sp. B7: BSQ44_20210Help
Entry
BSQ44_20210       CDS       T04603                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
meso  Mesorhizobium sp. B7
Brite
KEGG Orthology (KO) [BR:meso00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSQ44_20210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: APH73434
UniProt: A0A1L3SVR0
Position
4134146..4134538
Genome map
AA seq 130 aa AA seqDB search
MYRAITRDIEVSVEPFYLDDRSDPDDSHYVWAYRVTIANHSDDHVQLLSRYWHITDATGR
VEEVRGAGVVGEQPQLGPGDSYQYTSGCPLSTPSGIMVGRYTMRDTQGEQFDVAIPAFSL
DLPNGMRTVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgggcaataacacgcgatatcgaagtcagcgtcgagcccttctatctcgacgac
cgttcagacccggacgatagccattatgtctgggcgtacagagtcacgatagccaatcac
tcggatgatcacgtgcagttgctgtcgcgctactggcacatcaccgacgccaccggccgg
gtggaagaggtccgtggcgccggcgtcgtcggcgagcagccgcaactcgggcccggcgac
agctatcagtacacgtccggctgccccctctccactccgtcgggcatcatggtcggccgc
tacacaatgcgggacacgcagggcgaacagttcgacgtggcgatccccgccttctcgctc
gatcttcccaacggcatgcgcacggtgaactga

DBGET integrated database retrieval system