KEGG   Mesorhizobium sp. B7: BSQ44_21815Help
Entry
BSQ44_21815       CDS       T04603                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00260  Glycine, serine and threonine metabolism
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
meso01130  Biosynthesis of antibiotics
meso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSQ44_21815
Enzymes [BR:meso01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BSQ44_21815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: APH73722
UniProt: A0A1L3SWM5
Position
4468231..4469280
Genome map
AA seq 349 aa AA seqDB search
MIFASDNWAGAHPAIAAALSDHAGGFARAYGNSDLDRTVTDRFSKIFEREVAVFFVSTGT
AANSLSLVSVNKPGGVAFCHREAHMTEDEAGAPEYFTGGARLCPVDGPLGRIDPANLDAA
IARYPAEFIHSGRPMAISITQATEIGTVYGLDDIDAVAEVARRHNLPLHMDGARFANALV
SLDCSPAEMTWKRGVDLLSFGGTKNGCWCAEAVVLFDPGMAREFAFIHKRAAQLFSKSRF
VAAQFDAYFAGDLWLETARYSNAMAARLASHLRTSPCARLAWEPQANEVFAILSADVSAA
LQQKGVVFHPWHAPRGFAEEIAPDEAVCRFVTSFATTQKDVESLGALLA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgcttcagacaattgggccggtgcccatccggccatcgcggcggcgctttcc
gaccatgccggtggttttgcccgcgcctacggcaatagcgacctcgaccggacggtcacc
gacaggttcagcaaaatcttcgagcgtgaggtcgccgtgttcttcgtctcgaccgggacg
gcggcgaattcgctgtcgctggtctctgtcaacaagcccggcggggtggcgttctgtcac
cgcgaggcgcacatgacggaggatgaggctggcgcgccggaatactttaccggcggcgca
aggctctgcccggtcgacggtccgctcggccgtatcgatccggcgaacctcgatgccgcg
atcgcccgctatccggcggaattcatccattcgggccgcccgatggcgatctcgatcacg
caggcgaccgagatcggcaccgtctacggccttgacgacatcgatgccgtggcggaggtc
gccagacgccacaacctgccgctgcacatggacggggcacgcttcgccaacgccctcgtc
tcgctcgactgcagcccggcggagatgacgtggaagcgcggcgtcgacctcctgtcgttc
ggcggcaccaagaacggctgctggtgcgccgaggcggtggtgctcttcgatcccggcatg
gcgcgggagttcgccttcatccacaagcgcgcagcgcagctcttctcgaaatcgcgcttc
gtcgccgcccagttcgacgcctatttcgccggcgacctgtggctggagacggcgcgctac
tcgaacgccatggcagcccggctcgcctcccatctgcgcacctcgccgtgcgcgcggctt
gcctgggaaccgcaggccaacgaggtgttcgccattctgagcgcggacgtctcggccgcg
ttgcagcaaaagggcgtcgtcttccatccctggcacgcgccgcgaggcttcgcggaggag
atagcgccggacgaggcggtgtgccgcttcgtcaccagcttcgccaccacgcagaaggac
gtggagtctctcggcgcgttgctcgcctga

DBGET integrated database retrieval system