KEGG   Mesorhizobium sp. B7: BSQ44_21890Help
Entry
BSQ44_21890       CDS       T04603                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
meso  Mesorhizobium sp. B7
Pathway
meso00071  Fatty acid degradation
meso00072  Synthesis and degradation of ketone bodies
meso00280  Valine, leucine and isoleucine degradation
meso00310  Lysine degradation
meso00362  Benzoate degradation
meso00380  Tryptophan metabolism
meso00620  Pyruvate metabolism
meso00630  Glyoxylate and dicarboxylate metabolism
meso00640  Propanoate metabolism
meso00650  Butanoate metabolism
meso00900  Terpenoid backbone biosynthesis
meso01100  Metabolic pathways
meso01110  Biosynthesis of secondary metabolites
meso01120  Microbial metabolism in diverse environments
meso01130  Biosynthesis of antibiotics
meso01200  Carbon metabolism
meso01212  Fatty acid metabolism
meso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSQ44_21890
   00630 Glyoxylate and dicarboxylate metabolism
    BSQ44_21890
   00640 Propanoate metabolism
    BSQ44_21890
   00650 Butanoate metabolism
    BSQ44_21890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSQ44_21890
   00072 Synthesis and degradation of ketone bodies
    BSQ44_21890
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSQ44_21890
   00310 Lysine degradation
    BSQ44_21890
   00380 Tryptophan metabolism
    BSQ44_21890
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSQ44_21890
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSQ44_21890
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSQ44_21890
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:meso04147]
    BSQ44_21890
Enzymes [BR:meso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSQ44_21890
Exosome [BR:meso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSQ44_21890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C
Motif
Other DBs
NCBI-ProteinID: APH73732
UniProt: A0A1L3SWN7
Position
complement(4480579..4481748)
Genome map
AA seq 389 aa AA seqDB search
MARYDARIIGAFEHPTRFAPDKSIVQLHAECAIGAATDAGIDLSEVDGYFCAADAPGLGA
LSVMDYLNLTPRYADATELGGASYVAHVGRAARAIDAGLCNVALITLAGKPRSANRSSSA
AALAITGDRPERDFEVPFGPTTPASYALCAARHMHEYGTTSEQLAWIKVAASRHAAHNPN
AWLKDAVTVDDVMASPMIASPLHRLDCCVVTDGGGALILARPEVARTLGRPSIRVLGCGE
GIKHQGAGELDLTYTAAVHSGPVAFAESGLEHRQIQYASIYDSFTITVLLALEDLGFCKK
GQGGSFVEGGNLISGIGMLPFNTDGGGLCNNHPANRGGMTKVVEAVRQLRGEAHPALQVP
DCRFALCHGTGGALGTRHGCATLILSRED
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatatgacgcaaggatcatcggagctttcgaacatccgacccggttcgctccc
gacaagtcgattgttcagcttcatgccgaatgtgcgattggcgcagccaccgatgccggc
atcgatctatccgaagtcgatggctatttttgcgccgcagatgcgcccggcctgggcgct
ctgtcggtcatggactacctcaacctgacaccacgctatgctgatgccacggagcttggc
ggggcatcctacgtcgcgcatgtagggcgcgcggcgcgagccatcgatgcggggttgtgc
aacgttgccctcattacgctggcaggcaagccccgcagcgccaatcgatcctccagcgcg
gcagcgctcgccatcacaggcgaccgtcccgagcgcgatttcgaagtgccgtttggtccg
acaacccctgcaagctacgcgctgtgcgcggcacggcacatgcacgagtacggcacgaca
agcgaacaactcgcctggataaaggtcgcagcttcgcggcacgccgcgcataatccgaac
gcctggctgaaggatgcggtgacggtcgatgacgtgatggcatcacccatgatcgcctcg
ccgttgcaccgtctcgattgctgcgtcgtaaccgacggtggcggggcgcttatcctcgcc
cggcccgaggtcgcgaggacacttgggagaccctcgatcagagtgctgggctgcggcgag
ggcatcaagcaccaaggcgccggcgaactggatctcacatataccgccgcggtccattcc
ggacctgtcgcgttcgccgagtccggcctcgagcaccggcagatccagtatgcctcgatc
tacgacagcttcaccatcacggtgctgctggcgctggaagacctcggcttttgcaagaag
ggtcaaggcggcagcttcgtcgagggcggcaacctcatttcgggcatcggcatgcttcca
ttcaacaccgacggcggcggcctttgcaacaatcacccggcaaaccgcggcggcatgacc
aaggtcgtcgaggcggtgaggcaactccggggcgaagcgcatcccgcgctacaagtgccc
gactgtaggtttgcactctgccacggaacgggcggcgcgctgggtacccggcatggctgc
gccacgctgatcctgtccagggaggactga

DBGET integrated database retrieval system