KEGG   Mesorhizobium sp. Pch-S: C1M53_01165Help
Entry
C1M53_01165       CDS       T05918                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00520  Amino sugar and nucleotide sugar metabolism
mesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C1M53_01165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:mesp01005]
    C1M53_01165
Enzymes [BR:mesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     C1M53_01165
Lipopolysaccharide biosynthesis proteins [BR:mesp01005]
 Unusual sugar
  C1M53_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: QAZ41783
UniProt: A0A4P6GZR8
Position
complement(257690..258265)
Genome map
AA seq 191 aa AA seqDB search
MSKPPFIHESSYVDEGAEVGEGTKIWHFSHIMTRTRIGRNCSIGQNVVAGPDVTVGDNCK
VQNNVSLYKGVDLEPGVFCGPSCVFTNVLNPRAEIERKDEFRTTHVRRGATIGANATIVC
GNELGEYCMIGAGAVVTRDVPAYALMVGVPARRIGWVSRVGEILDESLTCPRTGERYFEH
SGTLVLVEGSD
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccgcctttcattcacgaaagttcatacgttgacgagggtgcagaggtcggc
gagggaacaaaaatatggcacttcagccacatcatgacccgcacccggatcggtcgaaac
tgctcgatcggacagaatgtcgttgctgggcctgacgttacggttggcgacaactgtaaa
gtgcaaaataacgtttcgctctataaaggtgtcgacttggagccgggcgtcttttgcggt
ccttcctgtgtcttcaccaatgttcttaatccgcgcgcagagatcgagcgcaaggatgag
tttcggacgacgcacgtacggcgaggtgccacgattggtgccaacgcgacaatcgtgtgc
ggcaatgagcttggcgaatattgcatgatcggggccggcgctgtggttacacgagatgtt
cccgcttacgcgttgatggtcggtgtacctgcgcgtcgtatcggctgggtgtcgagggtg
ggtgaaatactcgacgagtcgctgacgtgtcctcgtaccggtgagcgctatttcgagcac
agcggcacacttgttttggttgaaggcagcgactga

DBGET integrated database retrieval system