KEGG   Mesorhizobium sp. Pch-S: C1M53_03340Help
Entry
C1M53_03340       CDS       T05918                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00380  Tryptophan metabolism
mesp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    C1M53_03340 (kynA)
Enzymes [BR:mesp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     C1M53_03340 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase Sec7_N
Motif
Other DBs
NCBI-ProteinID: QAZ42151
UniProt: A0A4P6H0S0
Position
711262..712098
Genome map
AA seq 278 aa AA seqDB search
MSKPYDPSREGAQMSFKERMSYGDYLHLERVLDAQEPLSTAHDELLFIVQHQTSELWMKL
AIHEIRSAMREIRSDRPQPAFKMLTRVARIFEQLNNSWDVLRTMTPSEYTEFRNSLGQSS
GFQSYQYRAVEFLVGNRNTAMLGPHAHQPDLIAKLEEILAEPSLYDEALLLLSRNGFDIG
ADASRTSWRETREENPQVLEAWKAVYAAPQKYWDLYELAEKLVDFEDYFRRWRFNHVTTV
ERIIGLKRGTGGTGGVSYLRKMLEVVLFPELWTVRTVL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccctacgatccttcccgggaaggcgcgcagatgtcgttcaaggaacgcatg
tcctatggcgactatctgcatctcgagcgcgtgctcgatgcgcaggaaccgctttccacc
gcgcatgacgagctgttgttcatcgtgcagcaccagacgtcggaactgtggatgaagctg
gcgatccacgagatccgttcggcgatgcgcgagatccgttccgaccggccgcagccggcg
ttcaagatgctgacgcgcgtggcgcgcatcttcgagcagctgaacaattcctgggacgtg
ctgcgcaccatgacacccagcgaatataccgagttccgcaactcgctcggccagtcttcc
ggcttccagtcctatcagtatcgcgccgtcgagttcctggtcggcaaccgcaacaccgcc
atgctcgggccgcacgcgcatcagccggacctgatcgccaagctcgaggaaatcctggcc
gagcccagcctctatgacgaggcgctgctgcttttgtcacgcaacggcttcgacatcggc
gccgacgccagccgcaccagctggcgtgagacccgcgaggaaaacccgcaggttctggaa
gcatggaaggcggtctatgccgcgccgcagaaatactgggacctctacgaactcgccgaa
aagctcgtcgatttcgaggactacttccggcgctggcgtttcaaccatgtcaccacagtg
gagcgcatcatcgggctgaagcgtggcaccggcggcaccggcggcgtctcctacctgcgc
aagatgctggaagtggtgctgttcccggaactgtggaccgttcgcacggtactgtag

DBGET integrated database retrieval system