KEGG   Mesorhizobium sp. Pch-S: C1M53_04630Help
Entry
C1M53_04630       CDS       T05918                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K18614  2-(acetamidomethylene)succinate hydrolase [EC:3.5.1.29]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00750  Vitamin B6 metabolism
mesp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C1M53_04630
Enzymes [BR:mesp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.29  2-(acetamidomethylene)succinate hydrolase
     C1M53_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Ndr Esterase Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: QAZ42362
UniProt: A0A4V0YNT4
Position
complement(991453..992283)
Genome map
AA seq 276 aa AA seqDB search
MAAGIRSDQLISRRIETGGIALHVREGGCGPSLLFFHGITSNSAVFAPLMARLSDRFTTI
AVDQRGHGLSDKPETGYEANDYADDIAALIRTLDHGPAILVGHSLGARNSVTAAARYPDL
VRSVIAIDFTPYIETEALDALETRVNAGSRLFDDLKSVEAYLAARYPNIPADAIRIRAES
GYEKVDGGFRPLASPSAMAQTARGLRADLTQAYRDVTRPVLIVRGEQSKLVSPAALAKTS
RLRPDLPVVVVPDADHYVNETAPEITLKAITNFIDA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggcatacgctccgaccagctgatttcgcgacgcatcgagacggggggcatc
gccctgcatgtgcgcgagggaggctgcggcccgtcgctgctcttcttccacggcatcact
tccaattcggctgtctttgcaccgttgatggccaggctttcggatcgcttcacgaccatc
gcggtcgaccagcgcgggcatggcctcagcgacaagccggaaaccggctacgaggccaat
gactatgcggatgatatcgccgcgctgatccgcacgctcgatcacggacctgccatcctg
gtcggacattcgctcggcgccagaaactccgtcaccgctgccgcacgttatccggatctg
gtgcgttcggtcatcgcgatcgacttcacgccttacatcgagaccgaggcgctcgacgcg
ctggaaacccgggtgaacgcgggaagccggcttttcgacgacctcaagtcggtcgaggca
tatctggcggcccgctacccgaacattcccgcagacgccatcaggatcagggccgaaagc
ggctatgagaaagtcgatggcggctttcgtccgctggcgtcgccctcggccatggcccag
accgccaggggcctgcgcgcagacctgacccaggcctatcgggatgtgactaggccggtg
ctgatcgtccgtggcgaacaaagcaagctggtttcgccggcggcgctggcaaagaccagc
cggctgcggccggacctgccagtcgtcgtcgtcccggacgccgaccattacgtcaacgaa
acggctcccgagatcacgctgaaagccatcaccaatttcatcgacgcctga

DBGET integrated database retrieval system