KEGG   Mesorhizobium sp. Pch-S: C1M53_18660Help
Entry
C1M53_18660       CDS       T05918                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00010  Glycolysis / Gluconeogenesis
mesp00053  Ascorbate and aldarate metabolism
mesp00071  Fatty acid degradation
mesp00280  Valine, leucine and isoleucine degradation
mesp00310  Lysine degradation
mesp00330  Arginine and proline metabolism
mesp00340  Histidine metabolism
mesp00380  Tryptophan metabolism
mesp00410  beta-Alanine metabolism
mesp00561  Glycerolipid metabolism
mesp00620  Pyruvate metabolism
mesp00625  Chloroalkane and chloroalkene degradation
mesp00903  Limonene and pinene degradation
mesp01100  Metabolic pathways
mesp01110  Biosynthesis of secondary metabolites
mesp01120  Microbial metabolism in diverse environments
mesp01130  Biosynthesis of antibiotics
Module
mesp_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1M53_18660
   00053 Ascorbate and aldarate metabolism
    C1M53_18660
   00620 Pyruvate metabolism
    C1M53_18660
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C1M53_18660
   00561 Glycerolipid metabolism
    C1M53_18660
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C1M53_18660
   00310 Lysine degradation
    C1M53_18660
   00330 Arginine and proline metabolism
    C1M53_18660
   00340 Histidine metabolism
    C1M53_18660
   00380 Tryptophan metabolism
    C1M53_18660
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1M53_18660
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C1M53_18660
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C1M53_18660
Enzymes [BR:mesp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     C1M53_18660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QAZ47322
UniProt: A0A4P6HE01
Position
3947138..3948652
Genome map
AA seq 504 aa AA seqDB search
MTLSSETADLLGKLGVARDVLSGGDLVVRSPVTGEQLAALKTVSAADANKTIDAAHEAFK
AWRLVPGPKRGELVRLLGEELRAHKTELGRLVSIEVGKIPSEGLGEVQEMIDICDFAVGL
SRQLYGLTIATERPGHRMMETWHPLGVVGVISAFNFPVAVWSWNAALALVCGDAVVWKPS
EKTPLTALACAAIFARAVKRFGADAPANLAPVLIGEREIGEVLVDHAKVPLVSATGSTRM
GREVGPRLARRFARAVLELGGNNAGIVCPSADLDMALRAIAFGAMGTAGQRCTTLRRLFV
HESVYDQLVPRLKKAYESVSVGNPLETSSLVGPLIDKAAFDAMQKALKHAGEHGGTVTGG
ARVENGHGDAYYVRPALVEMPKQAGPVLEETFAPILYVMKYSDFDSVLELHNAVGAGLSS
SIFTRDLQESERFLAADGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYM
RRATNTVNYSKALPLAQGVSFDID
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatcgagtgaaacggcggatctgctggggaagcttggtgttgcacgggatgtg
ctttctggcggtgatctggttgtgcgcagcccggtgacgggtgagcagctggcagcattg
aagacggtctcggcagctgatgccaacaagacgatcgatgccgcccatgaggccttcaag
gcctggcgccttgtgcccggtcccaagcgcggcgaactggtgcgcctgctgggtgaggaa
ctgcgcgcccacaagaccgagctcggccgcctggtgtcgatcgaggtcggcaagatccct
tcggaaggattgggcgaagtccaggaaatgatcgacatctgcgacttcgccgtcggcctg
tcgcgtcagttgtacggcctgaccatcgccaccgaacgccccggccaccggatgatggaa
acctggcatccgctcggcgtcgtcggtgtcatctcggccttcaacttccccgtcgcggtg
tggtcgtggaatgccgcactggcgctggtctgcggcgatgcggtggtgtggaagccttcg
gagaagacgccgctgacggcacttgcctgcgcggcgatcttcgcgcgcgccgtcaagcgt
ttcggtgccgatgcccccgccaatctggcaccggtgctgatcggcgagcgcgagatcggc
gaagtgctggtcgatcatgcgaaagtgccgctggtctcggctaccggctcgacccgcatg
ggtcgtgaggtcggtccgcgcctggccaggcgtttcgcccgtgccgtgctggagctcggc
ggtaacaatgccggcatcgtctgcccgagtgccgatctcgacatggcgctgcgcgccatc
gccttcggtgccatgggcactgccggccagcgctgcaccacgctgcgccgcctgttcgtg
catgagagcgtctatgaccagctcgtgccgcgcctgaagaaggcctatgagagcgtctcg
gtcggcaatccgctggagacttcgtcgctggtcggcccgctgatcgacaaggcagccttc
gacgccatgcagaaggcgctgaaacatgccggcgaacatggcggcacggtcaccggcggc
gctcgcgtcgagaacgggcatggcgatgcctattatgtgcgtccggcgctggtggagatg
ccgaagcaggctggtccggtgctggaagagaccttcgcgccgatcctctatgtgatgaag
tattccgacttcgacagcgttcttgagctgcacaatgcggttggtgccgggctgtcgtcg
tcgatcttcacgcgcgatctgcaggaatcggagcggttccttgccgctgacggttcggac
tgcggcatcgccaacgtcaacatcggcacgtcgggagccgagatcggcggtgcgttcggt
ggcgagaaggagaccggcggcggtcgtgagagcggttcggatgcgtggaaggcttatatg
cggcgcgccaccaacaccgtgaactactccaaggcgctgccgctcgcccagggcgtctcc
ttcgacatcgactga

DBGET integrated database retrieval system