KEGG   Mesorhizobium sp. Pch-S: C1M53_24005Help
Entry
C1M53_24005       CDS       T05918                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C1M53_24005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mesp01002]
    C1M53_24005
Enzymes [BR:mesp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     C1M53_24005
Peptidases [BR:mesp01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   C1M53_24005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3
Motif
Other DBs
NCBI-ProteinID: QAZ45536
Position
complement(5122469..5123128)
Genome map
AA seq 219 aa AA seqDB search
MAFRFGILCFPKVQQLDLTGPYEVFASARDAEVHLVWKDLQPLRSATGLWLKPDTTFADA
PDFDVLCIPGGAGVNALLSDEETLAFIRGKAAAARFVTSVCTGALLLGRAGILSGRHATT
HWNAVDFLPGFGAIPTKARVVKDGSLITAGGVTSGIDFGLTVIAELIGREEAETIQLSLE
YAPEPPFGAGLPETSSASVVAAARAGMAGSRAEREALLF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgcttcggcatattgtgctttcccaaagtccaacaactcgacctgaccggc
ccttacgaagtgttcgcttcggcaagggatgcggaagttcatctcgtctggaaggatttg
cagcctctgcgctccgcaaccggcctctggttgaaaccggatacgaccttcgctgacgct
cctgatttcgacgttctttgcattcccggcggggctggcgtgaacgctctcctcagcgac
gaggagacgctcgcattcatccgcgggaaagctgccgctgcccggttcgtgacatcggtt
tgcaccggagcgctccttctcggacgagccggtatcctgtcagggcgtcatgcaacgacc
cattggaacgctgtcgactttctccccggttttggagcaatccccaccaaagcgcgcgtc
gtgaaggacggatcactgatcacggcaggcggcgtcacttccggcatcgacttcggtctg
acggtcattgctgaactgatcggtagggaagaagccgaaacgatccagctttcgctggaa
tacgctcctgaaccgccattcggtgcaggtctgcccgagacttcgtctgcgtcggtggtt
gcggcagcacgcgccggcatggctggctcaagggcggaacgagaagcgctcctgttctga

DBGET integrated database retrieval system