KEGG   Mesorhizobium sp. Pch-S: C1M53_24340Help
Entry
C1M53_24340       CDS       T05918                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mesp  Mesorhizobium sp. Pch-S
Pathway
mesp00361  Chlorocyclohexane and chlorobenzene degradation
mesp00625  Chloroalkane and chloroalkene degradation
mesp01100  Metabolic pathways
mesp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mesp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C1M53_24340
   00361 Chlorocyclohexane and chlorobenzene degradation
    C1M53_24340
Enzymes [BR:mesp01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     C1M53_24340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: QAZ47484
UniProt: A0A4P6HGT5
Position
complement(5192778..5193497)
Genome map
AA seq 239 aa AA seqDB search
MTVEALIFDVFGTCVDWRTGVAREVAAATAAKGLQVDSLAFADAWRDLYQPRMEEIRSGR
RSYVDLDVLHRENLDTTLDGFGIAGHFSEEERAALNHAWEKLPPWPDVVPGLIRLKANRI
VAPCSNGSIALMTRLARYGALPWDCILGAGIARAYKPDPRAYLTSCEALRLEPAQVMLVA
AHNNDLSAARACGLKTAFVARPQEHGTGQVTDLRASSHWDIVAADFPALSAHLDLRNHN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgaagccctcatcttcgatgttttcggcacttgtgttgactggcgcaccggc
gtcgcccgtgaggtggcggcagcgacagccgcgaagggactgcaggtcgacagcctcgct
ttcgcggatgcctggcgcgacctctatcagccgaggatggaggaaatacgctccggccgc
cgatcctatgtcgatctggacgtgctccaccgtgagaacctcgacacaacgctcgacggc
ttcggcatagccgggcatttcagcgaggaagagcgcgcagcgctcaaccacgcctgggaa
aagctgccgccgtggccggatgtcgttccgggcctgatacggctgaaggccaaccggatc
gtcgcaccatgctccaatggttcgatcgcattgatgacgcggctggcgagatatggcgcc
ctgccctgggactgcattctcggcgccggcattgcccgcgcctacaagcccgacccgcgc
gcttatctcacaagctgcgaagcgttgagacttgaacctgcacaggtcatgctggtggcc
gcgcataacaacgacctgtcagcagcgcgcgcgtgcgggctgaagacggcgttcgtggcg
cgcccacaggagcacggcaccgggcaggtgaccgacctcagggccagcagccactgggac
atcgtcgccgcggattttcccgcgctctccgcacatctcgatctgcgcaatcacaactag

DBGET integrated database retrieval system