KEGG   Mesorhizobium sp. WSM1497: A9K65_000575Help
Entry
A9K65_000575      CDS       T04915                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00061  Fatty acid biosynthesis
mesw00071  Fatty acid degradation
mesw01100  Metabolic pathways
mesw01212  Fatty acid metabolism
mesw02024  Quorum sensing
Module
mesw_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A9K65_000575
   00071 Fatty acid degradation
    A9K65_000575
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A9K65_000575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mesw01004]
    A9K65_000575
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mesw04147]
    A9K65_000575
Enzymes [BR:mesw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     A9K65_000575
Lipid biosynthesis proteins [BR:mesw01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   A9K65_000575
Exosome [BR:mesw04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   A9K65_000575
  Exosomal proteins of breast cancer cells
   A9K65_000575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ARP62038
UniProt: A0A1W6WZP5
Position
119079..121064
Genome map
AA seq 661 aa AA seqDB search
MAKASRTTAPVKAGAKAPSKAAGTAKPKAPVAKAAKPKAAAAPVRASTKPAAKAPAKAAA
GKTAPGRKAGAAKPAARPASKAAAAKPADATANRLPKALTALAAGLPEKPWLKSYPKNVQ
AEIGALPYSSIGDFLVAACKQFSAQPAFTCMDKSISYTDVERLSAAFGAYLQSKGLQKGA
RVALMMPNVLQYPVAMMAILRAGYVVVNINPLYTPRELEHQLKDSGAQAIVILENFANTL
QAVIARTAVKHVVVAAMGDMLGGLKGTIVNFVVRRVKKMVPAWSLPGHVKFNAAMKAGAG
MGFRPAKVAADDVAFLQYTGGTTGVSKGATLLHSNVLANVAQNAQWMEDAYTIKPKPAHP
NFICALPLYHIFALTVNALMGMQQGARNVLIPNPRDIPGFVKELQKYPVHIFPGLNTLFN
ALLNNEDFRKLDFKPLVLTLGGGMAVQKGVAERWKALTGCSVTEGYGLSETSPVATANKF
TAGDFTGTIGLPLPSTEIAIRDEDGNNLPLGEVGEVCIRGPQVMAGYWNRPDETAKVMTK
DGYFKSGDMGFMDERGYTKIVDRKKDMILVSGFNVYPNELEEVVAMHPGVLEVAAIGVPD
EHSGEVPKLFVVRKDPALTAEALTAFCRENLTGYKRPRYIEFRTELPKTPVGKILRRALR
E
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaagcatcaaggacgacggcgccggtgaaagcgggagccaaggcgccgtcgaaa
gcagccggtactgccaagccgaaagcacccgttgccaaagccgccaagccgaaggcggcc
gcggcacctgtaagggcaagcacaaagccggcggcgaaagccccggccaaggctgcggcc
ggaaagacggcgccggggcgtaaagcgggtgcggcaaagcccgctgccaggccggcctcg
aaggccgcggcggcaaagccggccgacgccaccgccaaccgattgccgaaagcgctgacg
gcgctggccgccggcttgccggaaaagccttggctcaagagctatccgaaaaacgtgcag
gcggagatcggcgccctgccctacagctcgatcggcgatttcctcgtcgccgcctgcaag
cagttttccgcgcagccggccttcacctgcatggacaagtccatcagctacaccgatgtc
gagcggctgtcggcggccttcggcgcctacctgcaatcgaagggcctgcagaaaggcgcg
cgcgtcgcgctgatgatgcccaacgtgctgcaatatccggtggcgatgatggcgatcttg
cgagcgggttatgtggtggtgaacatcaatccgctctacacgccgcgcgagctcgaacac
cagctgaaggattccggggcgcaagccatcgtcatcctggagaacttcgccaacaccttg
caggcggtgatcgccaggaccgcggtcaagcatgtggtggtcgccgcgatgggcgacatg
cttggcgggctgaagggcacgatcgtcaatttcgtcgtgcgccgcgtgaagaagatggtg
ccggcatggtcgctgcccgggcatgtcaagttcaatgccgccatgaaggccggcgccggt
atgggcttcaggccggccaaggtggcagccgacgatgtcgccttcctgcaatatacgggc
ggcaccacgggcgtctcgaagggcgccacgctgctgcacagcaacgtgctcgccaacgtc
gcgcagaacgcgcagtggatggaggacgcctacacgatcaagccgaaacccgcgcatccc
aacttcatctgcgcgctgccgctctatcatatcttcgcgctgacggtgaacgcgctgatg
ggcatgcagcagggcgcccgcaatgtgctcattcccaatccgcgcgacatcccaggcttc
gtcaaggaattgcagaaatatccggtgcacatctttcccggcctcaacacgctgttcaac
gcgctgctcaacaatgaggatttccgcaagctcgacttcaagccgctggtgctgacgctg
ggcggcggcatggcggtgcagaagggcgtcgccgaacgctggaaggcgctgaccggatgt
tcggtcaccgaaggctacggcctctcggaaacctcgccggtggccaccgccaacaagttc
accgccggcgacttcaccggcaccatcggcttgccgctgccctcgacggagatcgccatc
cgcgacgaagacggcaacaatttgccgctcggcgaggtcggcgaagtctgcatccggggg
ccgcaagtgatggcgggctactggaaccggccggatgagaccgccaaggtgatgaccaag
gacggctacttcaaatccggcgacatgggcttcatggacgagcgcggctacaccaagatc
gtcgaccgcaagaaggacatgatcctggtctcgggcttcaacgtctatcccaacgagctc
gaggaagtcgtggcgatgcatccgggtgtgctcgaagtggcggcgatcggcgtgccggac
gagcattcaggcgaggtgccgaaactgttcgtggtcaggaaggatccggcgctgaccgcc
gaggcactgaccgccttttgccgcgagaacctgaccggctacaagcggcccagatacatc
gaattccgcaccgaactgccgaagacgccggtcggcaagatcctgcggcgagcgctgcgc
gaatga

DBGET integrated database retrieval system