KEGG   Mesorhizobium sp. WSM1497: A9K65_006725Help
Entry
A9K65_006725      CDS       T04915                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00230  Purine metabolism
mesw00250  Alanine, aspartate and glutamate metabolism
mesw01100  Metabolic pathways
Module
mesw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9K65_006725
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9K65_006725
Enzymes [BR:mesw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     A9K65_006725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ARP63113
UniProt: A0A1W6X3S3
Position
1370029..1371327
Genome map
AA seq 432 aa AA seqDB search
MANVVVVGSQWGDEGKGKIVDWLSERADVVVRFQGGHNAGHTLVVDGKIYKLSLLPSGVV
RQGKLSIIGNGVVFDPHAFVAEVAKLKAQGVEVAPDRLKIAENTALILSLHRELDGFRED
AASNSGTKIGTTRRGIGPAYEDKVGRRAVRVMDLADLETLPLKVDRLLTHHNALRRGLGH
AEVTHDAIMQELTSVADDILPYMDRVWKILDDKRRAGERILFEGAQGTLLDIDHGTYPFV
TSSNTVAGQAAAGSGVGPGAIGYVLGITKAYTTRVGEGPFPTEQKNEVGEFLGTRGHEFG
VVTGRKRRCGWFDAVLVRQAVAVNGIKGIALTKLDVLDGLDEIKVCTGYRLDGEMIDYLP
ASQGAQARVEPVYETLEGWKGTTAGARSWNDLPAQAVKYVRYIEELIGAPVALLSTSPER
DDTILVTDPFQD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtggtggtcgtcggctcgcagtggggtgacgaaggcaagggcaagatcgtc
gactggctgtcggagcgcgccgatgtcgtggtgcgtttccagggcggccacaatgccggc
catacgctggtcgtcgacggcaagatctacaagctgtcgttgcttccgtcgggcgtcgtg
cgccagggcaagctgtccatcatcggcaatggcgtcgtgttcgacccgcacgctttcgtc
gccgaggtggcaaaactcaaggcgcaaggtgtcgaagtggcgccggatcgcctgaaaata
gccgaaaacacagcgcttatcctgtccctgcatcgagagctggacggatttcgtgaggac
gccgcatccaattccgggacgaagattggcacgacccgtcgcggcatcggccccgcctat
gaggacaaggtgggccggcgcgcggtcagggtgatggatttggcggatttggaaacactg
cccttgaaagtcgacaggctgctgacgcaccacaatgcgctgcgtcgcgggcttggtcat
gcggaagtcacgcatgacgcgatcatgcaggaactaacctcggtcgccgacgacatcctg
ccctatatggaccgggtctggaagatcctcgacgacaagcgccgggctggcgagcgcatc
ctgttcgagggcgcgcagggcacactgctcgatatcgaccacggcacctatccgttcgtg
acctcgtcgaacacggttgccggacaggctgccgccggctccggcgttggcccgggcgcc
atcggctatgtgctcggcatcaccaaggcctatacgacacgcgtcggcgagggtccgttc
ccgaccgagcagaagaacgaggtcggcgaattcctcggcacgcgcggccatgaattcggc
gtcgtcaccggtcgcaagcgccgctgcggctggttcgacgcggtgctggtgcgccaggcc
gtcgcggtcaacggcatcaagggcatcgcgctgaccaagctcgacgtgcttgacgggctg
gacgagatcaaggtctgcaccggttaccgtctcgacggcgagatgatcgattatctgccg
gccagccagggcgcgcaggcacgtgtcgaaccggtctacgagacgctcgagggctggaaa
ggcaccactgccggcgcgcgcagctggaatgatctgccggcccaggcggtcaagtatgtc
cgctacatcgaggagctcatcggcgcaccggtcgcgctcctttccaccagcccggaacgc
gacgacacgatacttgtgaccgatccgtttcaagactag

DBGET integrated database retrieval system