KEGG   Mesorhizobium sp. WSM1497: A9K65_006835Help
Entry
A9K65_006835      CDS       T04915                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00071  Fatty acid degradation
mesw00072  Synthesis and degradation of ketone bodies
mesw00280  Valine, leucine and isoleucine degradation
mesw00310  Lysine degradation
mesw00362  Benzoate degradation
mesw00380  Tryptophan metabolism
mesw00620  Pyruvate metabolism
mesw00630  Glyoxylate and dicarboxylate metabolism
mesw00640  Propanoate metabolism
mesw00650  Butanoate metabolism
mesw00900  Terpenoid backbone biosynthesis
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01120  Microbial metabolism in diverse environments
mesw01130  Biosynthesis of antibiotics
mesw01200  Carbon metabolism
mesw01212  Fatty acid metabolism
mesw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mesw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9K65_006835
   00630 Glyoxylate and dicarboxylate metabolism
    A9K65_006835
   00640 Propanoate metabolism
    A9K65_006835
   00650 Butanoate metabolism
    A9K65_006835
  Lipid metabolism
   00071 Fatty acid degradation
    A9K65_006835
   00072 Synthesis and degradation of ketone bodies
    A9K65_006835
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9K65_006835
   00310 Lysine degradation
    A9K65_006835
   00380 Tryptophan metabolism
    A9K65_006835
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9K65_006835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9K65_006835
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A9K65_006835
Enzymes [BR:mesw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9K65_006835
Exosome [BR:mesw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9K65_006835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FliC
Motif
Other DBs
NCBI-ProteinID: ARP63134
UniProt: A0A1W6X2X9
Position
complement(1395863..1397041)
Genome map
AA seq 392 aa AA seqDB search
MSASIVIASAARTPVGSFNGAFAATPAHELGAVVITELLSRAGVEPGEVDEVILGQVLTA
AQGQNPARQASINAGLPKETTAWGLNQVCGSGLRAIALGMQQIAIGDAKVIIAGGQESMS
LSTHAQHLRAGVKMGDFKLIDTMIKDGLWDAFNGYHMGNTAENVARQFQITREDQDQFAL
ASQNKAEAAQKAGKFKDEIVAVTINGKKGDTIVDQDEYIRHGATIDAMTKLKPAFDKDGT
VTAANASGINDGAAGALLMSEAEAVRRGITPLARIVSWATAGVDPQIMGTGPIPASRKAL
EKAGWSVGDLDLVEANEAFAAQACAVNKDMGWDPSIVNVNGGAIAIGHPIGASGARVFNT
LVFEMRRRGAKKGLATLCIGGGMGVAMCVEAL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttccatcgtcattgccagtgcggcgcgcacgccggtcggctccttcaacggc
gctttcgccgccaccccggcgcatgagctcggcgccgtcgtcatcacggaattgctgtca
cgcgccggcgtcgaaccaggcgaggtcgacgaggtcatcctcggccaggtgctgaccgcc
gcgcaaggccagaacccggcccgccaggcatcgatcaatgccggcctgcccaaggaaacc
accgcctggggcctcaatcaggtttgcggctcgggcctgcgcgccatcgcgctcggcatg
cagcagatcgccatcggcgatgccaaggtgatcatcgccggaggccaggaatcgatgtcg
ctttcgacgcatgcccagcacctgcgcgccggcgtcaagatgggcgacttcaagctgatc
gacaccatgatcaaggacgggctgtgggacgccttcaacggttaccacatgggcaacaca
gccgaaaacgtcgcgcgtcagttccagatcacccgcgaagaccaggaccagttcgcgctc
gcctcgcaaaacaaggccgaggccgcgcagaaggccggcaagttcaaggacgagatcgtc
gccgtcaccatcaatggcaagaagggcgacaccatcgtcgaccaggacgaatacatccgc
cacggcgccacgatcgacgccatgaccaagctgaaaccggctttcgacaaggacggcacg
gtaaccgccgccaacgcctccggcatcaatgacggcgccgccggcgcgctgctgatgagc
gaagcggaagcggtgaggcgcggcatcaccccgctggcgcgcatcgtgtcctgggcaacc
gccggcgtcgatccgcagatcatgggcaccggacccattcccgcctcgcgcaaggccttg
gaaaaggccggctggtcggtcggcgatctcgacctggtcgaggccaacgaagcctttgcg
gcgcaggcctgcgccgtcaacaaggacatgggctgggatccctcgatcgtcaacgtcaat
ggcggcgccatcgccatcggccatccgatcggtgcgtccggcgctcgcgtcttcaacacg
ctggtcttcgaaatgcgccggcgcggcgccaagaagggtctggctaccctgtgcatcggc
ggcggcatgggcgtcgccatgtgtgtcgaagcactctga

DBGET integrated database retrieval system