KEGG   Mesorhizobium sp. WSM1497: A9K65_014600Help
Entry
A9K65_014600      CDS       T04915                                 

Definition
(GenBank) dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9K65_014600
Enzymes [BR:mesw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A9K65_014600
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A9K65_014600
    1.1.1.-  
     A9K65_014600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Sacchrp_dh_NADP Shikimate_DH ADH_zinc_N_2 ApbA FAD_binding_3 TrkA_N ThiF
Motif
Other DBs
NCBI-ProteinID: ARP64467
UniProt: A0A1W6X6L3
Position
3034611..3035633
Genome map
AA seq 340 aa AA seqDB search
MKAARLYGPGDLRVEDIATPGAPDAGWVKLRVDAAGICGSDLHNFRTGQWISRSPSTAGH
ELTGTVTATGAGVDAFAIGDRVVADSRFWCGDCAQCQAGRRHLCASLGFVGEVCDGGFAE
QAVLPARLLHIIDAGLDERVAAMAEPLAVALHAVRRLPKTTGSVLVVGCGPIGGLAALLL
SRTFAGTVLIADRNQSRCARVARVTGARIVDLSRDAVAAATANAPLLAAIEATGSVAALN
QLLGVLDPGGTIAMVGIFHGRLDIDPNTLVEREIGLLGCHAFADELPEAVRMLGELSEPL
LALIDQEIGLDDIPAAYERLLAGRSDGLKTIIRMRQPVES
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcacgactttacgggcccggcgatctgcgcgtcgaggacatcgcgacgccg
ggcgcgccggatgcaggctgggtgaagctcagggtcgatgccgccggcatctgcggttcg
gacctgcacaatttccgcacgggacagtggataagccggtcgccttcgacggccggccat
gaactcaccggcacggtgaccgccaccggcgcgggcgtcgacgccttcgctatcggtgac
agggttgtcgccgattcccgcttctggtgcggagactgcgcgcaatgccaagccggcagg
cgtcatctctgcgcgtcactgggcttcgtcggagaggtctgcgacggcggttttgccgaa
caggccgtgctgcccgcacggcttttgcatatcatcgatgccgggctcgacgagcgggtc
gcggcaatggccgagccgctggcggtggcgctgcacgcggtgcggcgcctgccgaaaacg
acaggctccgtgctggtcgtcggttgcggaccgatcggcggtcttgccgccctgctgttg
tcgcggaccttcgccggcaccgtgctgatcgccgaccgcaaccagagccgctgcgcccgg
gtggcgcgggtgacgggtgcccggatcgtcgatctgagccgggacgccgttgccgccgca
actgccaatgccccgctgctcgcggccatcgaggcgaccggcagcgtcgcggcgctcaat
cagctgctcggcgttctcgatcccggcggtacgatcgccatggtcggcatcttccacggc
cgcctcgacattgatcccaatacgctggtcgaacgcgaaatcgggttgctgggatgccat
gcctttgccgacgaactgcccgaggccgtgcggatgctgggtgaattgagcgaaccgctg
ctggcgctgatcgaccaggagatcggcctggatgacattccggctgcctatgagcggctg
ttggcggggcgcagcgacggcttgaaaacaatcattcgcatgcggcaacctgtcgagtcg
tga

DBGET integrated database retrieval system