KEGG   Mesorhizobium sp. WSM1497: A9K65_016905Help
Entry
A9K65_016905      CDS       T04915                                 

Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
mesw  Mesorhizobium sp. WSM1497
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A9K65_016905
Enzymes [BR:mesw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     A9K65_016905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS PCMT FtsJ Methyltransf_2 CheR Methyltransf_32 CMAS RrnaAD MetW Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ARP64860
UniProt: A0A1W6X7N2
Position
3482346..3483113
Genome map
AA seq 255 aa AA seqDB search
MADWSAAQYLKFEDERTRPARDLVAQVPVDFPRRVVDIGCGPGNSTELLVERWPDAEVSG
FDTSPDMIEKARARLPEVTFDLADASKWQPAEPVDVIFANAVFQWLPEHPAVFQRLMGFL
APGGALAVQMPDNMGEDSHRLMRETAAEMPFAEKFKGAARGPLPPVSSYYDLLSPLSDRL
DIWHTIYNHPLADAEAIVEWVKSTGLKPFLDPLDSDERAMFLESYTAKIAKAYPKTASGK
VLLRFPRIFIVAKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctgattggtccgccgcccaatatctgaaatttgaagacgagcgcacgcggcccgcg
cgggatcttgtggcgcaggtgcccgtcgactttccacgccgggtcgtcgacatcggctgc
gggcctggcaactcgaccgaactgcttgtcgagcgctggccggatgctgaggtgagcggc
ttcgacacttcgcccgacatgatcgagaaggcgcgggcgcgcttgcccgaggtcaccttt
gatctcgccgatgcctccaaatggcagccggcggagccggtcgacgtgatttttgccaat
gcggtgttccagtggctgcccgagcatcccgcagtcttccagcggctgatgggtttcctc
gcgccaggcggcgcgctggccgtccagatgcccgacaatatgggcgaagactcgcaccgc
ctgatgcgcgagaccgccgccgaaatgccgtttgccgaaaagttcaagggcgcggcacgc
gggccgttgccgccggtgtcgtcctactatgacctcctgtcgccgctcagtgatcggctg
gatatctggcataccatctacaaccacccgcttgccgacgccgaagcgatcgtcgaatgg
gtgaagtcgacgggcctgaaaccgttcctcgatccgctggattccgacgaacgggcgatg
ttcctcgaaagctacacggccaagatcgccaaggcctatccgaaaacggctagcggtaag
gtgcttttgcgctttccacgcatcttcatcgttgccaagcgggcctga

DBGET integrated database retrieval system