KEGG   Mesorhizobium sp. WSM1497: A9K65_018540Help
Entry
A9K65_018540      CDS       T04915                                 

Definition
(GenBank) bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00250  Alanine, aspartate and glutamate metabolism
mesw00330  Arginine and proline metabolism
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9K65_018540
   00330 Arginine and proline metabolism
    A9K65_018540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mesw03000]
    A9K65_018540
Enzymes [BR:mesw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A9K65_018540
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A9K65_018540
Transcription factors [BR:mesw03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A9K65_018540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ARP65155
UniProt: A0A1W6X8J2
Position
3816549..3820163
Genome map
AA seq 1204 aa AA seqDB search
MPALDAIRQQIRANYLPDEDEAVKRLAEATGLSGKDRKAISARAADLVRAVRGSSDPRLM
EVFLSAYGLSTKEGVALMCLAEALLRVPDTETMDDLIADKIAPHDWSAHSGGSSSIFVNA
STWALMLTGRVLDEGEGGIEGTLRSMVRRLGEPVIRKAVAAAMREMGEQFVLGRTITEAV
KRGRPMTQKGYLYSFDMLGEAARTEADALRYHKAYADAISSLDSGSNGPDIRQNHGISVK
LSALHPRYEVAQKEEMLPVMAERLLSLALAARHSRMGLNIDAEEADRLDLSLDVIERVLA
EPELAGWNGFGVVVQAYGPRAAFAIDWLYALAKKYDRNIMVRLVKGAYWDTEIKRGQTLG
LTGYPVFTRKANTDVSYMACAKKLLGMTDRIYPQFATHNAHTVAAILSMADNNRDSFEFQ
RLHGMGEALHETVRRSEGTRCRIYAPVGAHSDLLAYLVRRLLENGANSSFVHQLTDEDVE
PEDIARDPLETVESQGPAANPAIARPSQIFGAGRRNSKGFDITDTVTLAAIDKARAAFAG
PDRWHAKPITRAAGYGKQRPIVNPAKPSEVVGTVSEAVAKQVATAVRFAVEAQPAWAKRP
VAERAAILNRAADLYEANAVEFFALATREAGKSLADGVAEVREAVDFLRYYATEAANAEA
GTQARGAIVCISPWNFPLAIFTGQIAAALVTGNSVIAKPAEQTPLIAFRAVELLREAGVP
EDVIQLLPGDGPSVGGPLTADPRIAGVCFTGSTEVAKLIEKQLAGTAAPDAMLIAETGGL
NAMIVDSTALPEQAVRDILASAFQSAGQRCSALRVLYVQKDVEKKMLEMLKGAMEALNVG
DPWRISTDVGPVIDDEAQSSIREYCTKMGLQGRLIAKLEAPREGRFVAPHVFRVKGIEDM
EREVFGPVLHVASFDADQIDAVIAAINRKGYGLTFGLHTRIEGRVQHFVDGIHAGNIYVN
RNQIGAVVGSQPFGGEGLSGTGPKAGGPHYLRRFRKGPEAGTHVQDGHKVTATELADNLP
DPTLGGWSTRPDRIAILRKHLRGKGAAAIGAAAGIDFGQVDLPGPTGEANTLSLSPRGRV
LCLGPDGDTLLAQTIQALAAGNAVLAVAPGAPAALSALTGKGLPLAAIDGRPDPVEARSL
RVDIVAFSGTPEAARIVRRVIADRSGPIVPLVSEVLNPAAYAHERAVCVDTTAAGGNASL
LAGA
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgccagcgctcgatgccatccgccagcagatccgcgccaactacctgcccgacgaagac
gaggccgtgaagcggcttgccgaggcgacgggactctccgggaaagaccgcaaggcgatc
tcggctcgtgccgccgatctggtgcgcgcggtgcgcggttcgtcggatccaaggctgatg
gaagtcttcctctccgcttacggtctctccaccaaggaaggcgtggcgctgatgtgcctg
gccgaggcgctgctgcgcgtgcccgataccgagacgatggacgacctcatcgccgacaag
atcgcgccgcacgactggtcggcgcattcgggcggttcgagctccatcttcgtcaacgcc
tcgacctgggcgctgatgctgaccggccgcgtcctcgacgaaggcgagggcggcatcgag
ggcacgctgcgttctatggtgcggcggctgggcgagccggtcatccgcaaggcggtggcc
gccgccatgcgcgagatgggcgagcagttcgtgctcggccgcaccatcactgaagccgtc
aagcgcggccggccgatgacccagaagggttatctctattccttcgacatgctgggcgag
gcggcccgcaccgaggccgacgccttgcgctatcacaaggcctatgccgacgcgatttcg
tcgctcgattccggctccaacggtcctgatatcaggcagaaccacggcatctcggtcaag
ctttcggcactgcatccgcgctacgaggtggcgcagaaggaagagatgctgcctgtgatg
gccgagcggcttttgtcgctggcgctggccgcgcgccattcgcgcatgggtctcaacatc
gatgccgaggaggccgaccgcctcgatctatcgctcgacgtcatcgagcgggtgctggcc
gagccggaacttgccggctggaacgggtttggcgtggtggtgcaggcgtatgggccacgc
gcggccttcgccatcgactggctctatgcgctggccaagaaatacgaccgcaacatcatg
gttcggctggtcaagggcgcctattgggacaccgagatcaagcgggggcagacgttggga
ctcaccggctatcccgtcttcacccgcaaggccaacaccgacgtctcctacatggcttgc
gccaagaagctgcttggcatgaccgaccgcatctacccgcagttcgccacccacaatgcc
cacaccgtcgccgccatcctgtcgatggctgataataaccgcgattccttcgagttccag
cgcctgcacggcatgggcgaggcgctgcacgagacggtgcgacggtccgaaggcacgcgc
tgccggatctatgcgccggtcggtgcgcattccgatctgctggcctatctggtgcgccgg
ctgctggagaacggcgccaactcctccttcgtgcaccagctgaccgatgaggatgtcgag
ccggaggacattgcgcgcgatccgctcgagacggtcgaaagccagggtccggcagccaat
ccggcgattgcccggccttcccagatttttggagccgggcgtcgcaattcgaaaggattc
gacatcaccgacacggtgacgctggcggcgatcgacaaggccagggcggccttcgccggg
ccggatcgctggcatgccaagccgattacgcgggccgccggctatggcaagcagcgtccg
atcgtcaacccggcaaagccttccgaagtggtcggcacggtcagcgaagcagttgccaag
caagtcgcgaccgccgtgcgcttcgcggtggaagcgcaaccggcctgggcgaagcgtccc
gtcgccgagcgcgccgccatcctcaaccgtgccgccgatctctatgaggccaatgccgtc
gagttctttgcactcgccacccgcgaggccggcaaatcgctggccgacggcgtcgccgag
gtgcgtgaagccgtcgacttcctgcgctactacgccactgaggcggccaatgcggaggcg
ggcacgcaagcgcgcggcgccattgtctgcatttcgccgtggaatttcccgctcgccatc
ttcaccggccagatcgcggcagcgctcgtcaccggcaattcggtgatcgccaagccggcc
gagcagacgccgctgatcgccttccgcgccgtcgaactgctgcgcgaggccggcgtgccg
gaagacgtcatccagttgctccctggcgacggcccatcggtcggcgggccgctcaccgcc
gatccgcgcatcgctggcgtctgcttcacaggttcgaccgaggttgccaagctgatcgag
aagcagctggccgggacggccgcgcccgacgccatgctgatcgccgagaccggcggcctc
aacgccatgatcgtcgattccaccgcgctgcccgaacaggcggtgcgcgatatcctcgcc
tccgccttccagagtgccggccagcgctgctcggcgctgcgcgtactctacgtgcagaag
gacgtcgagaagaagatgctggagatgctgaagggcgccatggaggcgctcaacgtcggc
gatccctggcggatttcgaccgatgtcggcccggttatcgacgacgaggcgcaaagctcg
atccgcgagtattgcacgaagatgggcctgcagggcaggctgatcgccaagctcgaggcg
cccagggaaggtcgcttcgtcgcgccgcatgtcttccgggtcaagggtatcgaggacatg
gagcgcgaggtgttcgggccggtgctgcatgtcgccagtttcgacgccgaccagatcgac
gcggtcatcgccgccatcaaccgcaagggttatggcctgaccttcggcctgcacacccgc
atcgagggccgcgtgcagcatttcgtcgatggcatccatgccggcaacatctatgtcaac
cgcaaccagatcggcgccgtcgtcggttcgcagccgtttggcggcgaggggctttccggc
accgggccgaaggccggcggtccgcactatctccgccgcttccgcaaggggccggaggcc
ggcacccatgtgcaggatggccacaaggtcacggcgaccgagcttgccgacaatctgcct
gatcccacacttggcggctggtcgacgcgtccggaccggatcgccattctgaggaagcat
ctgcgcggcaagggtgctgcggccattggtgcggccgccggcatcgatttcggccaggtc
gacctgcccgggccgaccggcgaagccaacacgctctcgctgtcgccacgtggacgggtg
ctgtgccttggtcccgatggtgatacgctgctggcgcagacgatccaggcgctcgccgcc
ggcaacgccgtgctggccgttgcaccgggcgcgccggcagccctttccgctctgaccggc
aagggcctgccgctggccgccatcgatggccggcctgatccggtcgaggcacgctcgctg
cgcgtcgatatcgttgctttttccggcacgccagaggccgcgcgcatcgtgcgcagggtt
atcgctgatcgctcaggcccgatcgtgccgctggtcagcgaagtgttgaacccggcggct
tatgcacatgagcgggccgtctgcgtcgacaccaccgccgcgggcggcaatgcgagcttg
ctggccggagcctga

DBGET integrated database retrieval system