KEGG   Mesorhizobium sp. WSM1497: A9K65_023200Help
Entry
A9K65_023200      CDS       T04915                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00260  Glycine, serine and threonine metabolism
mesw00630  Glyoxylate and dicarboxylate metabolism
mesw00670  One carbon pool by folate
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01130  Biosynthesis of antibiotics
mesw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A9K65_023200
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9K65_023200
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A9K65_023200
Enzymes [BR:mesw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     A9K65_023200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ARP65928
UniProt: A0A1W6XAS8
Position
4746783..4747883
Genome map
AA seq 366 aa AA seqDB search
MTGDDTKHLPLEDIHMAAGARFGAFAGWSMPLTYPAGVMKEHLHTREQAGLFDISHMKLF
EVSGPEAAALLNRACPLDAGALEISQSKLSFFLNEAGGILDDLIVTRLGDARFMVVANAG
NAVADEKHLRAHAADFDARIEPLDRVFLAIQGPEAWAALSRAGIETGSLLFMHGVEPRKN
WFMSRSGYTGEDGFEIGLPEADARDLVAKLLGDERVLWIGLAARDSLRLEAGLCLHGQDI
TPETDPASAALMWAIPKDIRASGTFIGADALRAAVERGPAQKRVGLKPEGRQPVRGGAAL
FDADGNPAGHVTSGGFGPSAGHPVAMGYVSTPLAKPGIRVFADVRGTKIPVDISSLPFTP
HRYRKG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgacgacacaaaacaccttccccttgaagatatccatatggccgccggtgcg
cgcttcggcgcctttgccggctggtcgatgccgctgacctatccggccggcgtcatgaag
gaacaccttcacacccgcgagcaggccggcctgttcgacatctcgcacatgaagctgttc
gaggtcagcggaccggaagcggcggcactgctcaaccgtgcttgcccactggatgccggc
gcgctcgaaatctcgcaatccaaactgtcctttttcctcaacgaagcaggcggcatcctg
gacgacctgatcgtcaccaggcttggcgatgccaggttcatggtggtcgccaatgccggc
aacgccgtagccgacgaaaagcatttgcgtgcacatgccgcggatttcgacgccaggatc
gagccgctcgaccgcgtcttcctggccatccagggtcctgaagcctgggccgccctttcc
cgcgccggcatcgagaccggctcgctgctgttcatgcatggggtcgaaccgcgcaagaac
tggttcatgagccggtcgggctataccggcgaggacgggttcgagatcggcttgccggag
gccgatgcacgcgacctcgtcgcgaagctgctcggagacgagcgcgtgctgtggatcggc
ctggctgcgcgcgacagtctgcgcctggaggccggtctctgcctgcatggccaggacatc
acaccggaaaccgacccggccagcgccgccttgatgtgggcaattccaaaggacatccgc
gcttccggcactttcatcggcgccgatgcgctccgcgccgcggtggaacgaggacccgcg
caaaagcgcgtcggtttgaagccggaaggccgccagccggtgcgtggcggtgccgcgctc
ttcgacgccgacggcaatccggccggccatgtcacatcgggcggcttcggcccctcggcc
ggccatccggtcgccatgggctatgtctcgacacctctggcaaagcccggaattcgggtt
ttcgccgatgtgcgcggcacgaaaatcccagtcgatatcagctccctgcccttcacaccg
catcgctaccgaaaaggatga

DBGET integrated database retrieval system