KEGG   Mesorhizobium sp. WSM1497: A9K65_032105Help
Entry
A9K65_032105      CDS       T04915                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mesw  Mesorhizobium sp. WSM1497
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    A9K65_032105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ARP67422
UniProt: A0A1W6XF32
Position
6603084..6603476
Genome map
AA seq 130 aa AA seqDB search
MYSAVTRNIEVQVRPFYLEDRSDPSENRYVWGYQITIDNQSDDFVQLLSRYWHITDGTGR
VEEVRGPGVVGDQPELNPGDSYQYTSGCPLSTPSGIMVGHYTMRNKRGETFDIAIPAFSL
DLPGTRRTVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatagcgccgtcacgcgcaacatcgaagtgcaggtcaggccgttctatctggaggac
cgttcggatccctctgagaaccgctatgtctggggctatcagataacgatcgacaatcag
tcggacgatttcgtgcagcttctgtcgcgctattggcacatcaccgacggcaccggccgg
gtcgaggaagtgcgcggccccggcgtggtcggcgaccagcccgaactcaatcccggcgac
agctaccagtacacgtccggttgcccgctctcgacaccgtccggcatcatggtcgggcat
tacacgatgcgcaacaagcggggcgagacgttcgacatcgccattccggcgttttcgctg
gacttgccggggacgcggcggacggtgaattga

DBGET integrated database retrieval system