KEGG   Mesorhizobium sp. WSM1497: A9K65_032115Help
Entry
A9K65_032115      CDS       T04915                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mesw  Mesorhizobium sp. WSM1497
Pathway
mesw00220  Arginine biosynthesis
mesw01100  Metabolic pathways
mesw01110  Biosynthesis of secondary metabolites
mesw01130  Biosynthesis of antibiotics
mesw01230  Biosynthesis of amino acids
Module
mesw_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mesw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A9K65_032115
Enzymes [BR:mesw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     A9K65_032115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N TOC159_MAD
Motif
Other DBs
NCBI-ProteinID: ARP67424
UniProt: A0A1W6XF36
Position
complement(6604666..6605577)
Genome map
AA seq 303 aa AA seqDB search
MSVRHFTDLSTVSEGDLRLMLDDAVVRKARLKAGERTKPLEGKVLAMIFDKPSTRTRVSF
DVGMRQLGGETIMLTGTEMQLGRSETIADTAKVLSRYVDAIMIRTTSHERLLELTENATV
PVINGLTDDTHPCQLMADIMTFEEHRGPVAGKTIAWTGDGNNVLHSLLEASARFRFNLNV
AVPEGSEPAQKHIDWSQAHGGKLHFTRSPEEAVDQADCIVTDCWVSMGQEHRARGHNVFS
PYQVNAKLMARAKPDALFMHCLPAHRGEEVTDEVIDGPHSVVFDEAENRLHAQKAVLAWC
LGA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttcgccatttcaccgatctttccaccgtttccgaaggcgacctgcgcttgatg
ctggacgacgcggtggtgcgaaaggcgcggctcaaggccggcgagcgcaccaaaccgctc
gaaggcaaggtgctcgcgatgatcttcgacaagccgtcgacgcgcacgcgcgtctccttc
gacgtcggcatgcggcagctcggcggcgagaccatcatgctgaccggcaccgagatgcag
ctcggccgttccgagaccatcgccgacaccgccaaggtgctgtcgcgctatgtcgatgcg
atcatgatccgcaccacctcgcatgagcggctgctggaattgaccgagaacgccaccgtg
ccggtgatcaacggactgaccgacgatacccatccctgccagttgatggccgatatcatg
accttcgaggaacatcgcggtccggtagccggcaagaccatcgcctggaccggcgacggc
aacaatgtgctgcattccctgctcgaggcctcggcccggttccgcttcaacctcaacgtc
gccgttcccgaaggcagcgagccggcgcagaagcatatcgactggtcgcaggcgcatggc
ggcaagctgcacttcacccgctcgcccgaggaagccgtcgatcaggccgactgcatcgtc
accgattgctgggtgtcgatgggccaggagcatcgcgcccgcggccacaatgtgttctcg
ccctaccaggtcaatgccaagctgatggcgagagccaagccggacgcgctgttcatgcac
tgcctgccggcgcatcgcggcgaggaagtgacagacgaggttatcgacggaccgcattcg
gtggtcttcgacgaggccgagaaccggctccatgcccagaaggccgtgcttgcctggtgt
ctaggcgcttga

DBGET integrated database retrieval system