KEGG   Methylobacterium sp. 4-46: M446_0223Help
Entry
M446_0223         CDS       T00679                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00010  Glycolysis / Gluconeogenesis
met00020  Citrate cycle (TCA cycle)
met00620  Pyruvate metabolism
met00710  Carbon fixation in photosynthetic organisms
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
Module
met_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M446_0223
   00020 Citrate cycle (TCA cycle)
    M446_0223
   00620 Pyruvate metabolism
    M446_0223
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    M446_0223
Enzymes [BR:met01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     M446_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ACA14796
UniProt: B0UFE2
Position
complement(272347..273957)
Genome map
AA seq 536 aa AA seqDB search
MSDIGVYNAAFGPDRAGLRNLKRVFWNLEAPSLYEQALQRGEAQLAAGGALVAETGIHTG
RSPKDKFVVRDSGTEDQVWWDNNGAITAEQFDRLHADFVAHAEGKDLFAQDLYGGAEPAY
RVRARVYTEYAWHSLFIRNLLIRPERDALGAYEPDLTIIDLPSFKADPARHGVRSETVIA
CDFTRKIVLIGGSSYAGEMKKSVFTYLNYILPKAGVMPMHCSANVGAQGDSALFFGLSGT
GKTTLSNDPARVLLGDDEHGWGPKGIFNFEGGCYAKTIRLSREAEPEIYATTERFGTVME
NVVIDPVTRLPDFDDASKTENTRCAYPLPFIPNASATGRAGHPKNIVMLTCDAFGVLPPI
AKLTGAEAMYHFLSGYTAKVAGTEKGLKGPEATFSTCFGAPFMPRHPSVYGNLLRDLIAR
HHVDCWLVNTGWTGGGVGTGRRMPIRVTRRLLTAALDGSLAKADYRRDPYFGFAVPTSVP
GVEPHILYPVKTWADKAAFAETAKRLVEMFQANFKRFEAHVDADVRAAEPTMSIAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacatcggcgtatacaacgcggcgttcggtccggatcgggccggcctgcgcaac
ctcaagcgcgtcttctggaacctggaggccccgagcctctacgaacaggcgctgcagcgg
ggcgaggcccagctcgcggcggggggcgcgctggtggccgagaccggcatccacaccggc
cggtccccgaaggacaagttcgtcgtccgggattccgggaccgaggatcaggtctggtgg
gacaacaacggcgcgatcacggccgagcagttcgaccgcctgcacgcggacttcgtcgcg
cacgcggagggcaaggacctcttcgcgcaggatctctacgggggagcggagccggcctac
cgggtgcgggcgcgcgtctacaccgagtatgcgtggcactccctgttcatccgcaacctg
ctgatccggccggagcgcgacgcgctcggcgcctacgagcccgacctgaccatcatcgac
ctgccgagcttcaaggccgacccggcccgccacggggtccgctccgagacggtcatcgcc
tgcgacttcacccgcaagatcgtgctgatcggcggctcgtcctatgccggcgagatgaag
aagtcggtcttcacctacctcaactacattctgccgaaggccggcgtgatgccgatgcac
tgctcggcgaacgtgggcgcgcagggcgactcggccctgttcttcggcctgtccggcacc
ggcaagaccaccctgtcgaacgacccggcccgggtgctgctgggcgacgacgagcacggc
tggggcccgaagggcatcttcaacttcgagggcggctgctacgccaagaccatccgcctg
tcgcgagaggccgagcccgagatctacgccacgaccgagcgcttcggcaccgtgatggag
aacgtggtcatcgacccggtcacccggctgccggatttcgacgacgcctcgaagaccgag
aacacgcgctgcgcctatccgctgccgtttatcccgaacgcgagcgcgacgggccgggcg
gggcacccgaagaacatcgtcatgctgacctgcgacgccttcggggtgctgcccccgatc
gccaagctcaccggcgccgaggcgatgtaccacttcctgtcgggctacaccgccaaggtg
gcgggcaccgagaaggggctgaaggggcccgaggcgaccttctcgacctgcttcggcgcg
cccttcatgccgcgccacccgagcgtctacggcaacctgctgcgcgacctgatcgcccgc
caccacgtcgattgctggctcgtcaacacgggctggaccggcgggggcgtgggcaccggg
cggcgcatgccgatccgggtgacgcgccggctgctgaccgccgccctcgacggctcgctc
gccaaggccgattaccgccgcgacccctatttcggcttcgcggtgccgacctcggtgccg
ggcgtcgagccgcacatcctctacccggtcaagacctgggcggacaaggcggccttcgcc
gagacggccaagcggctggtcgagatgttccaggccaacttcaagcgcttcgaggcccac
gtcgacgccgacgtgcgcgccgccgagccgaccatgtcgatcgcggcgtga

DBGET integrated database retrieval system