KEGG   Methylobacterium sp. 4-46: M446_0477Help
Entry
M446_0477         CDS       T00679                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00260  Glycine, serine and threonine metabolism
met00400  Phenylalanine, tyrosine and tryptophan biosynthesis
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01130  Biosynthesis of antibiotics
met01230  Biosynthesis of amino acids
Module
met_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M446_0477
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M446_0477
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M446_0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Fim-adh_lectin DUF561
Motif
Other DBs
NCBI-ProteinID: ACA15041
UniProt: B0UKV2
Position
complement(560614..561441)
Genome map
AA seq 275 aa AA seqDB search
MTTRLDDTFARCRAEGRAALVTYVMAGDPDPETSLQVLRALPEAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQTVSGTLALVRRFRAENRTTPVILMGYYNPLYIYGVARFLADAV
AAGVDGLIVVDLPPEEDDELCLPTQEAGLAFIRLATPTTDERRLPAVLANTSGFVYYVSI
TGITGSATPDFGQVEAAVARIRARTALPVVVGFGVKTGAHAAAIARGADGVVVGSALVDA
LARSLDLDGRATSGSVAAVSALVRDLAAGVRAAAR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgcctcgacgacaccttcgcccgctgccgcgcggagggacgcgccgccctc
gtcacctacgtgatggcgggcgatccggaccccgagacctcgctccaggtgctgcgcgcg
ctgcccgaggcgggcgccgacatcgtggaattcggcctgcccttcaccgacccgatggcg
gacggcccggcgatccaggcggcgggcctgagggcgctgaaggcgggccagaccgtgtcc
ggcaccctcgccctcgtgcgccggttccgggccgagaaccggaccacgccggtgatcctg
atggggtactacaaccccctctacatttacggcgtcgcgcgcttcctcgcggacgcggtc
gcggcgggggtcgacgggctcatcgtcgtcgacctgcccccggaggaggacgacgagctc
tgcctgccgacccaggaggcggggctcgccttcatccggctcgccaccccgaccacggac
gagcgccgcctgcccgccgtcctggcgaacacctcgggcttcgtctactacgtctcgatc
accggcatcaccgggtcggcgacgccggatttcggccaggtcgaggcggcggtggcgcgc
atccgcgccaggaccgcactcccggtggtggtcgggttcggcgtcaagaccggggcgcac
gccgccgcgatcgcccgcggcgcggacggcgtcgtggtcggctcggccctggtcgacgcg
ctcgcgcgctccctcgacctcgacgggcgcgccacctcgggcagcgtcgcggcggtctcg
gcgctggtgcgcgacctcgccgcgggcgtgcgcgccgccgcccgctga

DBGET integrated database retrieval system