KEGG   Methylobacterium sp. 4-46: M446_1246Help
Entry
M446_1246         CDS       T00679                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00071  Fatty acid degradation
met00072  Synthesis and degradation of ketone bodies
met00280  Valine, leucine and isoleucine degradation
met00310  Lysine degradation
met00362  Benzoate degradation
met00380  Tryptophan metabolism
met00620  Pyruvate metabolism
met00630  Glyoxylate and dicarboxylate metabolism
met00640  Propanoate metabolism
met00650  Butanoate metabolism
met00900  Terpenoid backbone biosynthesis
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01130  Biosynthesis of antibiotics
met01200  Carbon metabolism
met01212  Fatty acid metabolism
met02020  Two-component system
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M446_1246
   00630 Glyoxylate and dicarboxylate metabolism
    M446_1246
   00640 Propanoate metabolism
    M446_1246
   00650 Butanoate metabolism
    M446_1246
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M446_1246
   00072 Synthesis and degradation of ketone bodies
    M446_1246
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M446_1246
   00310 Lysine degradation
    M446_1246
   00380 Tryptophan metabolism
    M446_1246
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M446_1246
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M446_1246
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M446_1246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:met04147]
    M446_1246
Enzymes [BR:met01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M446_1246
Exosome [BR:met04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M446_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Ketoacyl-synt_C ACP_syn_III_C ketoacyl-synt DUF434
Motif
Other DBs
NCBI-ProteinID: ACA15770
UniProt: B0UGS7
Position
1372789..1373961
Genome map
AA seq 390 aa AA seqDB search
MSDVVIVSAVRTPVGAFNGSFASLPAHELGAIAIKAALERAKVSPEDVDEVIFGQVLTAG
AGQNPARQAAMAAGIPQEATAWGLNQLCGSGLRTVAVGLQQIANGDATVIVAGGQESMSM
APHAQHLRGGQKMGDLALVDTMLKDGLLDAFNGYHMGNTAENVAQRWQLTREEQDAFATR
SQNKAEAARKAGRFKDEIVPVTIKTRKGEVVVDADEYIREGATVEAMAKLRPAFSKEGTV
TAGNASGINDGAAAIVLMSAAEAAKRGLKPLARIASWATAGVDPAVMGTGPIPASRKALE
KAGWKPQDVDLIEANEAFAAQALAVNKELGFDDSKVNVNGGAIAIGHPIGASGARVLVTL
LHEMQKRDAKKGLATLCIGGGMGVAMCVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgtcgttatcgtttcagccgtgcgcacgcccgttggcgctttcaacggctcc
ttcgcgagcctgccggcgcacgaactcggcgccattgcgatcaaggcggcgctggagcgc
gccaaggtgtcgcccgaggacgtggacgaggtcatcttcgggcaggtgctcaccgcgggc
gcgggccagaacccggcccgccaggcggcgatggccgccggcatcccgcaggaggcgacg
gcctggggtctcaaccagctctgcggatcgggcctgcgcaccgtcgcggtcggcctgcag
cagatcgccaacggcgacgccaccgtcatcgtggcgggcggccaggaatcgatgtcgatg
gccccgcacgcccagcacctgcgcggcggccagaagatgggcgacctcgccctcgtcgac
acgatgctgaaggacggcctgctggacgccttcaacggctaccacatgggcaacaccgcc
gagaacgtcgcccagcgctggcagctcacccgcgaggagcaggacgccttcgcgacccgc
tcgcagaacaaggccgaggccgccaggaaggcgggccgcttcaaggacgagatcgtcccg
gtgaccatcaagacccgcaagggcgaggtggtcgtcgatgccgacgagtacatccgcgag
ggcgcgaccgtcgaggcgatggccaagctgcgcccggccttctccaaggagggcacggtc
acggccggcaacgcctcgggcatcaacgacggcgccgccgccatcgtgctgatgtcggcc
gccgaggccgcgaagcggggcctgaagccgctggcccgcatcgcctcctgggcgacggcc
ggcgtcgatcccgccgtcatgggcaccgggccgatcccggcctcccgcaaggccctggag
aaggccggctggaagccgcaggacgtcgacctgatcgaggcgaacgaggccttcgcggcc
caggcgctggcggtgaacaaggaactcggcttcgacgattccaaggtcaacgtgaacggc
ggcgccatcgcgatcggccacccgatcggcgcctcgggcgcccgcgtgctggtgaccctg
ctgcacgagatgcagaagcgcgacgccaagaaggggctcgccaccctctgcatcggcggc
ggcatgggcgtcgccatgtgcgtggaacgctga

DBGET integrated database retrieval system