KEGG   Methylobacterium sp. 4-46: M446_2341Help
Entry
M446_2341         CDS       T00679                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00260  Glycine, serine and threonine metabolism
met00750  Vitamin B6 metabolism
met01100  Metabolic pathways
met01110  Biosynthesis of secondary metabolites
met01120  Microbial metabolism in diverse environments
met01230  Biosynthesis of amino acids
Module
met_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M446_2341
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M446_2341
Enzymes [BR:met01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M446_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACA16800
UniProt: B0UFR6
Position
complement(2607932..2609347)
Genome map
AA seq 471 aa AA seqDB search
MLHVSTRGAAPPLTFTDALLAGLARDGGLYLPESWPSLAPETIAGLAGKPYAEAAKAVLA
PLVDGEIPRAALDRMIEAAYAGFRHPAVCPLVQLDANLFLLELHHGPTLAFKDVAMQLLG
RLMDHVLKARGSRATIVGATSGDTGSAAVEAFRGLDQVDVFILFPHGRVSEVQRRQMTSV
DSPNVHALAVEGTFDDCQAIVKALFQHPRFAEEVRLSGVNSINWARVAAQATYYFTSAVA
LGAPHRPVSFAVPTGNFGDILAGWVAKRMGLPVGRLMIGTNANDILARTLATGTYEVRGV
APTTSPSMDIQVSSNFERLLFEALGREPEGLTRLMAGLKQSGRFTLPPEVLKRVRSEFDA
AAVPEPEVAAEIRDTYARTGQILDPHSAIGVRAGRRLLEADPATPVVALATAHAAKFPDA
VEAATGIRPALPPHLADLMTRPERFSVVANDEGAVERVIRERARILRGAAA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgctccatgtctcgacgcgcggcgccgccccgccgctgaccttcaccgacgcgctcctc
gccggcctcgcccgcgacggcggcctctacctgcccgagagctggcccagcctcgcgccc
gagaccatcgcgggcctcgcgggcaagccctacgcggaggccgccaaggccgtgctcgcg
cccctcgtcgacggcgagatcccgcgcgccgcgctcgaccggatgatcgaggcggcctat
gccggcttccggcacccggccgtgtgcccgctcgtccagctcgacgcgaacctgttcctg
ctcgaactccaccacggcccgacgctcgccttcaaggacgtggcgatgcagctcctcggg
cggctgatggaccacgtgctcaaggcccgcggcagccgcgccaccatcgtgggcgccacc
tcgggcgacaccggcagcgccgccgtcgaggccttccgcggcctcgaccaggtcgacgtc
ttcatcctgttcccgcacggccgcgtgtcggaggtccagcggcgccagatgacgagtgtg
gactcgccgaacgttcacgcgctcgcggtcgagggcaccttcgacgattgccaggcgatc
gtgaaggccctgttccagcacccccgcttcgccgaggaggtgcggctctcgggcgtgaac
tcgatcaactgggcgcgggtcgccgcgcaggccacctactacttcaccagcgcggtcgcc
ctcggggcgccgcaccggccggtctccttcgcggtgccgaccggcaatttcggcgacatc
ctggccggctgggtcgccaagcggatgggcctgccggtcggccgcctgatgatcggcacc
aacgccaacgacatcctggcccgtaccctcgcgaccgggacctacgaggtgcgcggcgtc
gcccccaccacctccccctcgatggacatccaggtctcgtcgaatttcgagcgcctgctc
ttcgaggccctcggccgcgagccggaggggctgacccggctgatggccggcctgaagcaa
tccggccgcttcacgctgccgccggaggtgctgaagcgggtgcggagcgagttcgacgcc
gccgcggtgccggagccggaggtcgcggccgagatccgcgacacctacgcgcgcacgggg
cagatcctcgatccgcacagcgccatcggcgtgcgggcggggcgccggctgctcgaggcc
gatccggcgacgccggtcgtggcgctcgcgaccgcccacgcggcgaagttcccggacgcg
gtcgaggcggcgaccggcatccgcccggcgctgccgccccacctcgccgacctgatgacc
cggcccgagcgcttcagcgtggtggccaacgacgagggcgcggtcgagcgcgtcatccgc
gagcgggcgcgcatcctgcgcggggcggcggcgtga

DBGET integrated database retrieval system