KEGG   Methylobacterium sp. 4-46: M446_2758Help
Entry
M446_2758         CDS       T00679                                 

Definition
(GenBank) glycyl-tRNA synthetase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:met00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M446_2758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:met01007]
    M446_2758
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:met03016]
    M446_2758
Enzymes [BR:met01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     M446_2758
Amino acid related enzymes [BR:met01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   M446_2758
Transfer RNA biogenesis [BR:met03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    M446_2758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: ACA17196
UniProt: B0UNU1
Position
3067003..3067944
Genome map
AA seq 313 aa AA seqDB search
MTATDDALQPTRSFQGLILTLQRFWAAQGCVILQPYDMEVGAGTFHPATTLRALGPRPWK
AAYVQPSRRPKDGRYGENPNRLQHYYQFQVILKPNPPDLQDLYLASLRVIGVDLALHDIR
FVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVAGFECAPVAGELTYGLERLAMYVQ
GVENVYDLNFNGLDGPERVSYGDVFLQAEQEYSRHNFEAADTEMLFRHFRDAEAACRRYL
DFGEPGPAANDARHRMAQPAYDQCIKASHVFNLLDARGVISVTERQSYILRVRDLAKACG
AAWLRTQAGGAAG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgacgacgcccttcagccgacgcgctcgttccagggcctgatcctgacg
ctgcagcgcttctgggccgcgcagggctgcgtaatcctgcagccctacgacatggaggtg
ggcgccggcaccttccacccggcgacgaccctgcgggcgctcgggccccggccgtggaag
gccgcctacgtgcagccctcgcgccgcccgaaggacgggcgctacggcgagaacccgaac
cggctccagcactattaccagttccaggtcatcctgaagccgaatccgcccgacctgcag
gacctctacctcgcctcgctgcgggtaatcggggtcgacctcgccctccacgacatacgc
ttcgtcgaggacgactgggagagcccgacgctgggcgcctggggcctcggttgggaatgc
tggtgcgacgggatggaggtgagccagttcacttacttccagcaggtcgcgggcttcgaa
tgcgccccggtggcgggcgagctcacctacgggctcgagcgcctcgccatgtacgtccag
ggcgtcgagaacgtctacgacctcaacttcaacggcctcgacgggccggagcgggtcagc
tacggcgacgtgttcctgcaggccgagcaggaatactcgcgccacaatttcgaggcggcg
gataccgagatgctcttccgccacttccgcgacgcggaggcggcctgccgccgctacctc
gacttcggcgagccaggcccggcggcgaacgacgcccgccaccggatggcgcagccggcc
tacgaccagtgcatcaaggcgagccacgtcttcaacctgctcgacgcgcgcggggtgatc
tcggtgacggagcgccagagctacatcctgcgggtgcgcgacctcgccaaggcctgcggc
gcggcgtggctacgcacccaggcggggggcgcggccggctga

DBGET integrated database retrieval system