KEGG   Methylobacterium sp. 4-46: M446_3193Help
Entry
M446_3193         CDS       T00679                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00230  Purine metabolism
met01100  Metabolic pathways
Module
met_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M446_3193
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     M446_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_28 AAA_22 TsaE EFP AAA CoaE ABC_tran cobW CPT CbiA AAA_29 AAA_30 RsgA_GTPase Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ACA17599
UniProt: B0UNZ1
Position
complement(3536316..3536975)
Genome map
AA seq 219 aa AA seqDB search
MSVGSQTPVSRRGLVLILSSPSGAGKTTLTRALAQQPEWGLELSVSVTTRARRPSEIDGQ
HYRFIDRETFEQLRERDDMLEWAEVHGNFYGTPRRPVERALAAGRDMIFDIDYQGTRQVR
AKLRDDVVTIFILPPSMAELRRRLERRAEDSRETIERRLRNARSEIERWSEYDYVLVNDD
LDRSFKTLEAILSAERLRRTRQVGLDAFVAGLLAEPAGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggggtcgcagacgccggtgtcgcggcgcggtctggtcctgatcctgtcctcg
ccctcgggggcgggcaagacgacgctgacccgcgccctcgcccagcagcccgaatggggg
ctcgagctctcggtctcggtgacgaccagggcccggcggccctccgagatcgacggccag
cactaccgcttcatcgaccgggagaccttcgagcagctgcgcgagcgcgacgacatgctc
gaatgggccgaggtgcacggcaatttctacggaacgccgcgccgcccggtcgagcgggcg
ctcgcggccggccgcgacatgatcttcgacatcgattaccagggcacgcggcaggtgcgc
gccaagctgcgcgacgacgtggtgacgatcttcatcctgccgcccagcatggcggagctg
cgccgccgcctggagcgccgggccgaggattcccgcgagacgatcgagcggcgcctgcgc
aatgcccgcagcgagatcgagcgctggtcggaatacgactacgtcctcgtcaacgacgac
ctcgaccgctccttcaagaccctggaggcgatcctcagcgccgagcgcctgcgccgcacc
cggcaggtcgggctcgacgccttcgtggcggggctcctcgccgaaccggcgggcggctga

DBGET integrated database retrieval system