KEGG   Methylobacterium sp. 4-46: M446_5756Help
Entry
M446_5756         CDS       T00679                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00790  Folate biosynthesis
met01100  Metabolic pathways
Module
met_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:met00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M446_5756
Enzymes [BR:met01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     M446_5756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACA20044
UniProt: B0UE01
Position
complement(6318049..6318525)
Genome map
AA seq 158 aa AA seqDB search
MTDAYLGLGSNLGDKAAMLEAAIAGLDAAPGLRVTARSRFYRTPPWGDTDQDWFLNAAVA
VATDLTPHALLDACLALEARLGRVRARRWGPRVIDIDVLHYAGAAVEDERLVLPHRFVRA
RAFVLVPLAEIAPDLVIGGETVTAALAKLDRTGIEPVE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcctatctgggtctcggcagcaacctcggcgacaaggccgccatgctggag
gcggccatcgccggcctcgacgccgcgccgggcctgcgcgtcaccgcccgctcgcgcttc
taccgcacgcccccctggggcgacaccgaccaggactggttcctgaacgccgccgtcgcg
gtggcgaccgacctgaccccgcacgcgctgctcgacgcctgcctcgccctcgaggcgcgg
ctcggccgcgtgcgcgcgcggcgctgggggccccgcgtcatcgacatcgacgtgctgcac
tatgccggcgccgcggtcgaggacgagcggctggtcctgccccaccgcttcgtgcgcgcg
cgcgccttcgtcctggtgcccctcgcggagatcgcccccgacctcgtcatcggcggcgag
accgtgaccgcggcgctggccaagctcgaccgcaccgggatcgagccggtggaatga

DBGET integrated database retrieval system