KEGG   Methylobacterium sp. 4-46: M446_5857Help
Entry
M446_5857         CDS       T00679                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00072  Synthesis and degradation of ketone bodies
met00280  Valine, leucine and isoleucine degradation
met00650  Butanoate metabolism
met01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M446_5857
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    M446_5857
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M446_5857
Enzymes [BR:met01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     M446_5857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: ACA20144
UniProt: B0UGE7
Position
6440590..6441255
Genome map
AA seq 221 aa AA seqDB search
MAWTRDQMAARAARELQDGFYVNLGIGIPTLVSNYIPEGMSVQLQSENGMLGMGPFPYEG
EEDPDLINAGKQTITELPTTSYFSSSDSFAMIRGGHIDLSILGAMQVAENGDLANWMIPG
KMVKGMGGAMDLVAGVKKVVVVMEHVAKAKDGAESPKLLKACDLPLTGTQVVDMVITDLG
VFTIDKKGGGGMSLIELADGVTEEEVRAKTEGRYRVALRNT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcctggacccgcgaccagatggcggcccgcgctgcccgcgaattgcaggacggtttc
tacgtcaacctcggcatcggcatcccgaccctggtgtcgaactacatccccgagggcatg
tcggtgcagctccagtcggagaacggcatgctcggcatgggccccttcccgtacgagggc
gaggaggacccggacctgatcaacgccggcaagcagaccatcacggagctgccgaccacg
agctacttctcgtcgtcggattccttcgcgatgatccgcggcgggcacatcgacctgtcg
atcctgggcgccatgcaggtggccgagaacggcgacctcgccaactggatgatccccggc
aagatggtgaaggggatgggcggcgccatggacctcgtggcgggcgtcaagaaggtcgtg
gtggtgatggagcacgtcgccaaggccaaggacggcgcggagagcccgaagctcctgaag
gcctgcgacctgccgctgaccggcacgcaggtggtcgacatggtgatcaccgatctcggc
gtcttcaccatcgacaagaagggcggcggcggcatgagcctgatcgagctcgccgacggc
gtcaccgaggaggaggtgcgcgccaagaccgagggccgctaccgggtggcgctccgcaac
acctaa

DBGET integrated database retrieval system