KEGG   Methylobacterium sp. 4-46: M446_6468Help
Entry
M446_6468         CDS       T00679                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
met  Methylobacterium sp. 4-46
Pathway
met00450  Selenocompound metabolism
met00970  Aminoacyl-tRNA biosynthesis
met01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:met00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    M446_6468
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M446_6468
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:met01007]
    M446_6468
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:met03016]
    M446_6468
Enzymes [BR:met01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     M446_6468
Amino acid related enzymes [BR:met01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   M446_6468
Transfer RNA biogenesis [BR:met03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    M446_6468
 Prokaryotic type
   Other AARSs
    M446_6468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Herpes_ICP4_N
Motif
Other DBs
NCBI-ProteinID: ACA20727
UniProt: B0UB35
Position
complement(7110988..7112535)
Genome map
AA seq 515 aa AA seqDB search
MAGERFTITTAISYPNGAPHIGHAYEVIAADAIARFKRIDGYDVFFTTGTDEHGLKIQQT
AAKAGISPRAFVDAMAPRFRTMAETLNCGFDRFIRTTDPDHIASSQALWRRMEAAGDIYL
AKYAGWYSVRDEAYYDEAELVLGQDGVRRAERTGTPVEWVEEESYFFRLSAYADRLLAHY
AEHPDFIGPETRRNEVVSFVRSGLQDLSVSRTTFDWGVPVPGAPGHVMYVWVDALTNYIT
SCGFPDEADPRWRRWPADLHVIGKDIIRFHAVYWPAFLMSAGVPLPRRVFGHGFLLSRGE
KMSKSLGNVVDPIALAGLYGVDPLRYFVLREVPFGQDGNYSHEAIVNRTNADLANDLGNL
AQRSLTMIARNCDGAVPRPGDLAEADRAILAAADALPAVARAAMEDYALHHALAEIWAVV
AEANRYFAAQEPWTLRKTDPARMATVLYCTAETLRAVGILVQPFVPAAACRLLDLLAVPG
EARGLAQVGEGGRLVPGTALPAPSPIFPRFVEPEA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgaacgcttcaccatcaccacggcgatctcgtatccgaacggcgccccgcat
atcgggcacgcctacgaggtgatcgccgccgacgccatcgcgcgcttcaagcgcatcgac
ggctacgacgtgttcttcaccaccggcaccgacgagcacgggctgaagatccagcagacc
gccgccaaggcgggaatctccccgcgcgccttcgtggacgcgatggcgccgcgcttccgc
accatggcggagacgctgaactgcggcttcgaccgcttcatccgcaccaccgatcccgac
cacatcgcgtcctcgcaggcgctgtggcggcggatggaggcggccggcgacatctacctc
gcgaagtatgccggctggtactcggtgcgcgacgaggcctattacgacgaggcggagctg
gtgctcggccaggacggggtgcgccgcgccgagcggaccggcacgccggtcgagtgggtc
gaggaggagagctacttcttccgcctctccgcctacgcggaccggctgctcgcccactac
gccgagcacccggacttcatcgggccggagacccgccgcaacgaggtggtgagcttcgtg
cgctcgggcctgcaggacctgtcggtgagccgcaccaccttcgactggggcgtcccggtg
cccggcgcgcccggccacgtgatgtacgtctgggtcgacgcgctcacgaactacatcacg
tcctgcggcttcccggacgaggcggatccgcgctggcgccgctggccggccgacctgcac
gtgatcggcaaggacatcatccgcttccacgcggtctactggccggccttcctgatgtcg
gccggggtgccgctgccccggcgcgtcttcggccacggcttcctgctcagccgcggcgag
aagatgtcgaagtccctcggcaacgtggtcgacccgatcgcgctcgccgggctctacggg
gtcgacccgctgcgctacttcgtgctgcgcgaggtgcccttcggccaggacggcaactac
tcgcacgaggcgatcgtcaaccgcaccaacgccgacctcgccaacgacctcggcaacctc
gcccagcgctcgctgaccatgatcgcgcgcaattgcgacggggcggtgccgcggcccggc
gacctcgccgaggcggaccgggcgatcctcgccgccgccgacgcgctgccggcggtcgcc
cgcgccgccatggaggattacgccctgcaccacgcgctcgccgagatctgggccgtggtg
gcggaggccaaccgctacttcgcggcccaggagccctggaccctgcgcaagaccgacccg
gcccggatggcgaccgtgctctactgcacggccgagaccctgcgcgcggtcggcatcctg
gtgcagcccttcgtgccggcggccgcctgccggctcctcgacctcctggcggtgcccggg
gaggcgaggggattggcgcaggtcggggaggggggccggctcgtcccgggcacggccctg
cctgccccgagcccgatcttcccgcgcttcgtcgagccggaggcctga

DBGET integrated database retrieval system