KEGG   Methylobacterium sp. AMS5: Y590_22215Help
Entry
Y590_22215        CDS       T04283                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00071  Fatty acid degradation
meta00072  Synthesis and degradation of ketone bodies
meta00280  Valine, leucine and isoleucine degradation
meta00310  Lysine degradation
meta00362  Benzoate degradation
meta00380  Tryptophan metabolism
meta00620  Pyruvate metabolism
meta00630  Glyoxylate and dicarboxylate metabolism
meta00640  Propanoate metabolism
meta00650  Butanoate metabolism
meta00900  Terpenoid backbone biosynthesis
meta01100  Metabolic pathways
meta01110  Biosynthesis of secondary metabolites
meta01120  Microbial metabolism in diverse environments
meta01130  Biosynthesis of antibiotics
meta01200  Carbon metabolism
meta01212  Fatty acid metabolism
meta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y590_22215
   00630 Glyoxylate and dicarboxylate metabolism
    Y590_22215
   00640 Propanoate metabolism
    Y590_22215
   00650 Butanoate metabolism
    Y590_22215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y590_22215
   00072 Synthesis and degradation of ketone bodies
    Y590_22215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Y590_22215
   00310 Lysine degradation
    Y590_22215
   00380 Tryptophan metabolism
    Y590_22215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Y590_22215
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Y590_22215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y590_22215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:meta04147]
    Y590_22215
Enzymes [BR:meta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Y590_22215
Exosome [BR:meta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y590_22215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C Phage_lysis ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMB47670
UniProt: A0A0X1SP38
Position
4806609..4807784
Genome map
AA seq 391 aa AA seqDB search
MRTHTRSDTVILGYARTPMGGLMGSLRGLTAPQLGAAAIRAALDRSGAVEVDRVLMGCVL
LGGLGQAPARQAALAAGLPEAVPCTAVSKVCGSGMEALILGHALLQAGLARRVVAGGMES
MSNAPHLLPDLRGGARLGHRGAVDSLFHDGLEDAYEPGRLMGSFGDRIAAEYGFTRAEQD
AFALESLRRALAAQAEHAFARELVGVPSGSAQVEQDEQPGKAKPEKIPTLRPAFSPDGTV
TAANASSISDGAAALVLADAADAEAAGLAPLARLVGTASHAGPPARFACAPVPAIRALLE
QVGWGVGEVDLFEINEAFALVPMIAMRELGIPHARLNVHGGACALGHPLGASGARIVATL
LGALKARGLRRGVASLCIGGGEATALALEIT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacccacacccgttccgacaccgtcatcctcggctacgcccgcaccccgatgggc
ggcctgatgggaagcctgcgcgggctcacggcaccgcaactcggcgccgccgcgatccgc
gccgcgctcgaccgatccggggccgtcgaggtggaccgggtgctgatgggctgcgtgctg
ctcggcggtctcggccaggcgccggcccggcaggcggcgctcgccgcgggactgccggag
gcggtcccctgcaccgcggtgagcaaggtctgcggctccggcatggaggccctgatcctc
ggccacgccctgctgcaggctgggctcgcgcgccgcgtggtggcgggcggcatggagagc
atgagcaacgcaccccacctcctgccggatctgcgcggcggtgcccggctcggccaccgc
ggcgcggtcgacagcctgttccacgacggtctggaggacgcctacgagccggggcggctc
atgggcagcttcggcgaccggatcgcggccgagtacggcttcacccgcgccgagcaggac
gccttcgcgttggaaagcctgcgccgggcgctggccgcgcaggcggagcacgccttcgca
cgcgaactcgtcggcgtcccctccggctcggcgcaggtcgagcaggacgagcagcccgga
aaggccaagcccgagaagatcccgaccctgcggccggccttctcgccggacgggaccgtg
acggcggccaatgccagctcgatttccgacggagccgccgccctcgtcctggccgatgcg
gccgacgcggaagccgcggggctggcgcctctggcccgcctcgtcggcacggcgtcccat
gctgggccgcccgcacgcttcgcctgcgcgcccgtccccgccatccgagccctgctggag
caggtggggtggggtgtcggtgaggtcgatttgttcgagatcaacgaggccttcgcgctg
gtgccgatgatcgcgatgcgggagctcggcatcccgcacgcgcgcctcaacgtccacggc
ggcgcctgcgcgctcggccatccgctcggggccagcggcgcccgcatcgtcgcgacgctc
ctcggtgccctgaaggcccgcgggttgaggcgcggcgtcgccagcctctgcatcggcggc
ggcgaagcgacggctctcgccctggagatcacttga

DBGET integrated database retrieval system