KEGG   Methylobacterium sp. AMS5: Y590_24125Help
Entry
Y590_24125        CDS       T04283                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00860  Porphyrin and chlorophyll metabolism
meta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Y590_24125
Enzymes [BR:meta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Y590_24125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AMB48054
UniProt: A0A0X1SQ54
Position
5244892..5246349
Genome map
AA seq 485 aa AA seqDB search
MTRALMLQGTGSDVGKSLLVAGLARAFTRRGLTVRPFKPQNMSNNAAVTADGGEIGRAQA
LQARAARVAPSVHMNPVLLKPQSEVGAQVVVQGRMIGTARAREYQTWKPRLMASVLDSFE
RLRSEADIVLVEGAGSPAEVNLRQGDIANMGFARATGTPVVLVGDIDRGGVIASLVGTQA
VLEPDDAAMIRGFIVNRFRGDPTLFADGMALIAARTGWSPLGLVPFFADAGRLPPEDAVA
LDAPQAPRDGALPLIAVLRFPHIANFDDLDPLRQEPGVAVTFVPPGEPVPADADLIILPG
SKTTIDDLECLRAEGWDIDIRAHLRRGRRVLGLCGGYQMLGRSIADPQGIEGAPRDVPGL
GLLDVETVMTGEKRLVAATGTTLADGAPFSGYEMHVGDTTGPDTARPLLRLADGRVDGAV
SGDGLVTGTYVHGLFADDHQRAAWLARLGAAPGLTRYEAGIEEVLDRFADHLEAHLDCDG
LLRLR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgccctgatgctccaggggaccggatccgatgtcggcaagtcgctgctggtg
gccggcctcgcccgtgccttcacccggcgcggcctgacggtgcgtccgttcaagccgcag
aacatgtcgaacaacgccgccgtcaccgccgatggcggcgagatcggccgggcccaggcg
ctccaggcccgcgccgcgcgggtcgcgccctcggtccacatgaacccggtcctcctgaag
ccgcagagcgaggtcggcgcgcaggtggtggtgcaggggcggatgatcggcaccgcgcgg
gcacgggagtaccaaacctggaagccgcgcctgatggcctccgtgctcgacagcttcgag
cggctgcgcagcgaggcggacatcgtgctcgtggagggcgcgggctcgccggccgaggtg
aacctgcggcagggcgacattgccaatatgggttttgcccgggcgacgggaacgccggtg
gtgctcgtcggcgacatcgatcggggcggcgtcatcgccagcctcgtcggcacgcaggcg
gtgctggagcccgacgatgcggcgatgatccgcggcttcatcgtcaaccgctttcgcggc
gacccgacgctgtttgccgacggcatggccctgatcgccgcgcgcaccggctggtccccg
ctcggcctcgtgccgttctttgccgatgccggccgcctgccgccggaggatgcggtggcg
ctcgatgcccctcaagcgccccgcgacggcgccttgccgctgatcgcggtgctgcgcttt
ccgcacatcgccaattttgacgacctcgacccgctgcggcaggagcctggcgtcgccgtg
accttcgtgccgcccggcgagcccgtcccggcggacgccgatctcatcatccttccgggc
tccaagaccacgatcgacgatctcgaatgtctgcgcgcggaaggatgggacatcgatatc
cgcgcccatctgcgccgcggccgtcgcgtgctcgggctgtgcggcggctaccagatgctc
ggccgctccatcgccgatccgcagggaatcgagggtgcgccgcgtgacgtgccgggtctc
ggtctcctcgacgtcgagacggtgatgacgggcgagaagcgcctcgtcgccgccaccggc
acgacgctcgcggatggcgcgccgttctccggctacgagatgcatgtcggcgatacgacc
gggccggacaccgcccgacccctgctgcgcctggccgacgggcgggtcgacggtgccgtc
tcaggcgatgggctcgtgaccggcacctatgtccacggcctgttcgccgacgaccaccaa
cgcgcggcctggctcgcccggctcggcgccgcgcccggcctcacccgctacgaggccggc
atcgaagaggtgctcgaccgcttcgccgaccacctcgaagcgcatctcgactgcgacggg
ctgctgcgcctgcgctga

DBGET integrated database retrieval system