KEGG   Methylobacterium sp. AMS5: Y590_24610Help
Entry
Y590_24610        CDS       T04283                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit N
  KO
K04038  light-independent protochlorophyllide reductase subunit N [EC:1.3.7.7]
Organism
meta  Methylobacterium sp. AMS5
Pathway
meta00860  Porphyrin and chlorophyll metabolism
meta01100  Metabolic pathways
meta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:meta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Y590_24610
Enzymes [BR:meta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Y590_24610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AMB48153
UniProt: A0A0Y0G4F3
Position
complement(5354956..5356224)
Genome map
AA seq 422 aa AA seqDB search
MNAHAPLPATECGVSVRAEHGQRAVFCGLTGIVWLHRKIQDAFFLVVGSRTCAHLIQSAA
GVMIFAEPRFATAIIDERDLAGLADMNEELDRVVTRLIERRPDIRLLFLVGSCPSEVIKL
DLSRAAQRLSRRLAPDVRVLNYSGSGIETTFTQGEDACLASLVPELPEAAATDELLVVGA
LADVVEDQFARLFSDLGIAARFLPARRAGQMPPVGRGTRFLLAQPFLADTARALEERGGQ
RIAAPFPLGAEGTTEWLRAAAEAFSVDAARFEAVTAPGLRRSRQALAAYAEKLAGKRVFF
FPDSQLEVPLARFLSREMGAELIEVGTPYLHRGHLAAELEWLPSGTAVVEGQSLDDGLDR
CRAARPDLTVCGLGLANPLEAEGLTTKWSIELLFTPIQGYEQAGDLAELFARPLERRTRL
EV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgcacgcgccccttcccgccaccgagtgcggcgtctcggtgcgcgccgagcac
ggccagcgggccgtgttctgcggcctcaccggaatcgtctggctccaccggaagatccag
gacgcgttcttcctcgtcgtcggttcgcgcacctgcgcccacctgatccagtcggcagcg
ggcgtgatgatctttgccgagccgcgctttgccaccgccatcatcgacgagcgcgatctc
gccggcctcgccgacatgaacgaagaactcgaccgggtggtgacgcggctgatcgagcga
cgtcccgacatccggctgctgttcctcgtcggttcctgtccctcggaagtcatcaagctc
gacctgtcgcgggcagcccagcgactgtcgcggcggctcgccccggacgtgcgggtgctg
aactattcgggctccggcatcgagacgaccttcacgcagggcgaggatgcctgcctcgcc
tcgctcgtgccggaactgcccgaggcggcggcaacggatgaactcctcgtcgtcggcgcg
ctcgccgacgtggtcgaggaccagttcgcccggttgttctccgatctcggcatcgctgcc
cgcttcctgccggcgcgacgggcgggccagatgcccccggtcggacgcggcacgcgcttt
ctcctggcccagcccttcctcgcggacaccgcgcgcgccctggaagagcgcggaggtcag
cgcatcgccgccccgttcccgctcggtgccgagggcacgaccgagtggcttcgcgcggcg
gccgaggccttcagcgtcgatgccgcccgcttcgaggcggtaacggcgccgggcctgcgc
cgttcccgccaggccctggccgcgtacgccgaaaagctcgccggcaagcgggtgttcttc
ttccccgattcacagctcgaagtgccgctcgcccgcttcctttcgcgggagatgggcgcc
gaactgatcgaggtcggcacgccctatctgcatcgcggccacctcgccgccgaactcgaa
tggctccccagcggcaccgccgtggtggagggccaaagcctcgacgacgggctcgaccgc
tgccgcgccgcccggccggatctgaccgtgtgcggcctcggcctcgccaacccgctcgag
gcggaggggctgaccacgaagtggtcgatcgagctgctgttcacgccgatccaaggctac
gagcaggcaggcgacctcgccgaattgtttgcgcgcccgctcgagcggcgcacccggctg
gaggtgtag

DBGET integrated database retrieval system