KEGG   Methanosphaera sp. BMS: AW729_09050Help
Entry
AW729_09050       CDS       T05504                                 

Definition
(GenBank) digeranylgeranylglycerophospholipid reductase
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
metb  Methanosphaera sp. BMS
Pathway
metb00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:metb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AW729_09050
Enzymes [BR:metb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     AW729_09050
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     AW729_09050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Trp_halogenase DAO FAD_oxidored FAD_binding_2 HI0933_like GIDA Pyr_redox_2 Lycopene_cycl NAD_binding_8 Pyr_redox_3 Thi4 AlaDh_PNT_C Pyr_redox NAD_binding_7 AviRa
Motif
Other DBs
NCBI-ProteinID: AWX33224
UniProt: A0A2Z4LA01
Position
complement(2436569..2437759)
Genome map
AA seq 396 aa AA seqDB search
MTQIEVDVLVIGAGPAGSMAARESSKNGAETLIIDKKAEIGTPKRCAEGIMSGVLERMDI
HVDKRCIARDIDGARIVSPDNTSAWFTSETLETPATGIVLERKVFDKHLTMDAIREGAKV
MLRCEATSMKKVDDGFIVDVKSQLDEVDRIKAKIVIAADGPEGRVASWGGLDTKVSLAEM
ESGAQYEMTNLKMENSRVIQFYFGNIAPGGYAWIFPKGHDIANVGIDISNVKTDKTALEC
LDEFVASCDETKNAQAVELNVGGNPYCGVFDKIISDNLLLVGDAAGCVSPITGGGIDTAL
ESGMIAGRVAARCVKENDCSQSNLSEYSDYIEEHIAKKFRKYISIRDFLYNLEDDDLNEY
ITALANADISTLSTKSLIKALLKVSPRKLLKLRKLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatagaagttgatgtattggttataggagcaggtcctgccggttctatggct
gcaagagaatccagcaaaaatggtgctgaaacattaattattgataagaaagcagagata
ggtacacctaagcgttgtgctgagggcattatgagtggtgttcttgaaaggatggacatt
cacgtcgataaaagatgcattgcaagggatattgatggagcacgtatcgtctctccagac
aacaccagtgcatggtttacctcggaaaccttggaaacacccgccaccggtatcgtgctt
gaacgtaaggtatttgacaaacatcttaccatggatgcaataagggaaggtgcgaaggtc
atgcttagatgtgaagcgacatccatgaaaaaggttgatgatggatttattgtagatgtt
aaaagtcaactggatgaggttgacagaatcaaagcaaaaattgtcattgcggccgacgga
ccggagggccgtgtagccagttggggcggacttgacaccaaagtatccttggctgagatg
gaatcaggtgcccagtatgagatgacaaacttaaaaatggaaaacagtagggttattcag
ttttactttggcaacatagcccccggaggttatgcatggattttcccaaagggccatgac
atagcaaatgtgggaattgacatatccaacgttaagaccgacaagaccgcacttgaatgc
ttggatgaatttgtagcaagctgtgatgaaaccaaaaatgcccaggccgtggaattgaat
gtaggaggaaatccatactgtggcgtatttgacaagataatctcagataacctgttgctt
gtcggagatgcagccggatgtgtaagtccaattaccggaggaggtattgacacggcactt
gaaagtggtatgattgcaggacgtgttgctgccagatgcgttaaggagaatgattgcagc
caatccaatctgagcgaatactctgattatatcgaagagcatatagccaagaagtttaga
aagtacattagcataagggacttcctatataacttggaagatgatgatttaaacgagtac
attacggcacttgccaatgcggatataagtacattatccaccaagtcattgattaaggct
ctgcttaaggtttcccctagaaaattattaaagttaagaaaactactctaa

DBGET integrated database retrieval system