KEGG   Methanothermobacter sp. CaT2: MTCT_0743Help
Entry
MTCT_0743         CDS       T04009                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
metc  Methanothermobacter sp. CaT2
Pathway
metc00300  Lysine biosynthesis
metc00680  Methane metabolism
metc01100  Metabolic pathways
metc01120  Microbial metabolism in diverse environments
metc01130  Biosynthesis of antibiotics
metc01210  2-Oxocarboxylic acid metabolism
metc01230  Biosynthesis of amino acids
Module
metc_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:metc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MTCT_0743
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MTCT_0743
Enzymes [BR:metc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     MTCT_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C MTTB
Motif
Other DBs
NCBI-ProteinID: BAM69992
UniProt: T2GHW4
Position
complement(729455..730003)
Genome map
AA seq 182 aa AA seqDB search
MDQIEHEVKGDTMEGIIRGRVWRFGDNVDTDMIIPGRYLRTFSLDELASHVMEGARPEFA
SQVRKGDIIVAGRNFGCGSSREQAPVALKHAGVVAIIAESFARIFYRNAINIGLPVIMAK
VEADDGDEVSVDLRSGQIRNLTAGSEYRMKPFNEYMLSILEDGGLVNHYLKTINTGISGD
EG
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatagaacacgaggttaagggagatacaatggaaggaatcataagaggaaga
gtatggagattcggtgacaacgtggatacagatatgattataccgggccgttacctgagg
accttcagtctggatgaactggcctcccatgtgatggagggtgcaagacccgaatttgcc
tctcaggtcaggaagggagacattatcgtcgccggacgcaacttcggctgcggatcatca
agggaacaggcccctgtcgccctgaaacatgcaggtgtggttgcaataatagccgaatcc
tttgcaaggatattctacagaaacgccataaacatagggttacctgttataatggcgaag
gtggaggctgatgacggggatgaagtatccgtcgatctgagaagcggccagatcaggaac
ctcacagcaggcagtgaataccggatgaaacccttcaatgagtacatgctatcaatcctc
gaggacggcggactcgtgaatcactacctcaaaacaatcaatactggcatatcaggagat
gaggggtag

DBGET integrated database retrieval system