KEGG   Methanothermobacter sp. CaT2: MTCT_1279Help
Entry
MTCT_1279         CDS       T04009                                 

Definition
(GenBank) fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
metc  Methanothermobacter sp. CaT2
Pathway
metc00051  Fructose and mannose metabolism
metc01100  Metabolic pathways
metc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:metc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MTCT_1279
Enzymes [BR:metc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MTCT_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAM70527
UniProt: T2GJB7
Position
1256411..1256977
Genome map
AA seq 188 aa AA seqDB search
MNPVREVVDVSLHIYRTGLVSGIGGNVSARMGDRVFITPTMVPLGEVSLRNVVVVDLNGG
VIRGGRPSSELGLHLEVYRARPDVGGIVHTHSPHARAFSIAGVQIEKMEGFMGLGRGYIP
MVPYHPPGSRELAAECGRVMVDEDAAILENHGVVCAGEGLRDALLLAEFIEESARTQFIA
ETLKSMKK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccggtaagagaagtcgttgatgtttcacttcatatttacaggaccggccttgta
tccggcataggtggaaatgtgagtgcaagaatgggtgatagggtcttcataaccccgacc
atggtccccctgggggaggtttcactcaggaatgtcgttgtggtggacctcaatggaggg
gtcatcaggggagggaggccatcatctgaactgggactccaccttgaggtatacagggca
cggccagatgtgggtggaatagtgcacacccattcgccccatgcgagggctttctccatt
gcaggagtccagattgagaagatggagggattcatgggtctcgggaggggttacataccc
atggtcccgtaccacccgccaggtagcagagaacttgcagctgaatgtggcagggtaatg
gttgatgaggatgctgccatcctggagaaccatggagttgtatgtgcaggtgaaggttta
agggacgcccttctactggcggaattcattgaggagtctgcaaggacccagttcatagcc
gagaccctgaaatccatgaaaaaataa

DBGET integrated database retrieval system