KEGG   Methylobacterium sp. DM1: C0214_05525Help
Entry
C0214_05525       CDS       T05461                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00520  Amino sugar and nucleotide sugar metabolism
metd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C0214_05525
Enzymes [BR:metd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     C0214_05525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind 3Beta_HSD NAD_binding_10 NAD_binding_4 adh_short KR Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-ProteinID: AWI87806
UniProt: A0A2U8HS88
Position
complement(1187098..1188171)
Genome map
AA seq 357 aa AA seqDB search
MKSRAADGQDGRHVLVAGGAGFIGSHLVDALLARGARVVALDSLLTGRRDNLAHLAREPR
FELVEADVTQPLPALPRFDRIFNLACAASPPHYQADPMHTMMTSVVGTNHLLERARADGA
RFLQASTSEVYGDPEVHPQTESYWGHVNPTGPRACYDEGKRSAETLVFDFERVHRLDVRV
ARIFNTYGTRMRADDGRVGSNVVCQALAGEPITVYGNGEQTRSFCYAADLVEGLMRLMDR
ETSPGGPVNLGNPREMTVAELVELVTRMTDTRSAVVRRPLPVDDPQRRRPDITRAQTLLG
WSPQVPLEQGLEATIAWFAKEIRPPEPAARANLGRFVGSRPFQPAEPALGDLAQGST
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtcgagcggcggacggtcaggacggcaggcacgtgctcgtggccgggggcgcg
ggcttcatcggttcgcacctcgtcgatgcgctgctggcgcggggcgcccgcgtcgtcgcc
ctcgacagccttctgaccgggcgccgcgacaacctcgcccatctggcccgcgagccccgg
ttcgaactggtcgaggcggatgtgacgcagccgctgccggcgctgccgcggttcgaccgc
atcttcaatctcgcctgcgccgcctcgccgccgcactaccaggcggacccgatgcacacg
atgatgacgagcgtcgtcggcaccaatcacctcctggagcgggcgcgggcggacggggcg
cgcttcctgcaggcctccaccagcgaagtctacggcgaccccgaggtgcatccgcagacg
gaatcctactggggccacgtcaacccgaccggtccgcgcgcctgctacgacgagggcaag
cgctcggccgagaccctggtcttcgatttcgagcgggtgcaccggctcgacgtgcgggtg
gcgcgcatcttcaacacctacggaacccggatgcgggccgatgacgggcgcgtcggctcg
aacgtcgtgtgtcaggcgctcgcgggcgagccgatcaccgtctacggcaacggcgaacag
acccgctcgttctgttacgccgccgacctcgtcgaggggctgatgcggctgatggaccgc
gagacctcgcccggcggcccggtcaatctcggcaacccgcgcgagatgacggtggcggaa
ctggtcgaactcgtcacccggatgacggatacccgctcggcggtggtgcgccgcccgctg
cccgtcgatgacccgcagcgccgccggcccgacatcacccgcgcgcagacgcttctcggc
tggtcgccgcaggtgccgctcgaacaggggctggaggcgaccattgcgtggttcgccaag
gagatccgcccgcccgagccggccgcgcgggcaaatctcgggcgcttcgtcggcagccgc
ccgttccagccggccgagccggcgctcggggatctcgcgcaagggtcgacataa

DBGET integrated database retrieval system