KEGG   Methylobacterium sp. DM1: C0214_07180Help
Entry
C0214_07180       CDS       T05461                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00430  Taurine and hypotaurine metabolism
metd00620  Pyruvate metabolism
metd00640  Propanoate metabolism
metd00680  Methane metabolism
metd01100  Metabolic pathways
metd01120  Microbial metabolism in diverse environments
metd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C0214_07180
   00640 Propanoate metabolism
    C0214_07180
  09102 Energy metabolism
   00680 Methane metabolism
    C0214_07180
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C0214_07180
Enzymes [BR:metd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     C0214_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AWI88072
UniProt: A0A2U8HQK3
Position
1530539..1531708
Genome map
AA seq 389 aa AA seqDB search
MTPSKDAVILVLNAGSSSVKFALFSAETLQPLCRGGIEGIGSRARFGGASGARAHLFEDG
LPEDSDHAAATHWLLDRIRRTDGLRLSAAGHRVVHGGPDFAAPVVIDEAVMTALEALIPL
APAHQPHNLAAIRAVSGAWPDLPQVACFDTAFHRTMPRLAQIFAIPHELTDQGLVRYGFH
GLSYQHIADVLPRIAGERARGRVIVAHLGHGASLCALHGGRSVATTMGFTALDGLMMGMR
CGAIDAGLVLHLIEQRGMAPAEVSEMLNRRSGLLGVSGISNDARTLLASDDPRAAEALDL
FAYRVVREAGSMMAALGGLDAFVFTAGIGERSARIRAAIAEGLAWTGLRLDAARNAANDT
RISTDDATIPVYVVPADEELPIARAVRSR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgccctcgaaggacgccgtcatcctggtgctgaacgccggctcgtcgagcgtgaag
ttcgcgctgttttcggccgagacgttgcagccgctctgccgtggcggcatcgagggcatc
ggcagccgggcacggttcgggggcgccagcggcgcgcgggcgcacctgttcgaggacggt
ctgcccgaagacagtgaccacgcggcggccacgcactggctgctcgaccgcatccgccgc
accgacggcctacgcttgagcgcggccggccaccgcgtcgtccatgggggcccggatttc
gcggcgccggtggtgatcgacgaggccgtgatgacggccctggaagccctgatcccgctg
gctccggcgcaccagccgcacaacctcgcggcgatccgcgccgtcagcggcgcgtggccg
gacctgccgcaggtcgcctgcttcgacacggcgttccaccgcaccatgccgcggcttgct
cagatcttcgcgatcccgcacgagctgaccgatcagggcctcgtccgctacggcttccac
gggctgtcgtatcagcacatcgccgacgtgctgccgcggatcgcgggcgagcgggcgcgg
ggccgggtcatcgtcgcgcatctcggccacggggcgagcctgtgcgccttgcacgggggg
cgcagcgtcgccaccaccatgggcttcaccgcgctcgacggcctgatgatgggcatgcgc
tgcggcgccatcgatgccggcctcgtgctccacttgatcgagcagcgcggcatggcaccc
gcggaggtgtccgagatgctgaaccggcgctcgggcctgctcggtgtctccgggatcagc
aacgacgcccgcaccctgctggcgagcgacgaccctcgcgccgccgaggcgctcgatctg
ttcgcctaccgcgtggtgcgcgaggcgggctcgatgatggccgcgctcggcggcctcgac
gccttcgtcttcaccgccggcatcggcgagcgctcggcccggatccgcgcggccatcgcc
gaggggctggcctggaccggcctgcgcctcgacgcggcgcgcaacgcggccaacgacacc
cggatcagcaccgacgatgcgacgatccccgtctatgtcgtgcccgccgacgaggaattg
ccgatcgcccgtgccgtgcggtcgcgctga

DBGET integrated database retrieval system