KEGG   Methylobacterium sp. DM1: C0214_09595Help
Entry
C0214_09595       CDS       T05461                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
metd  Methylobacterium sp. DM1
Pathway
metd00020  Citrate cycle (TCA cycle)
metd00310  Lysine degradation
metd00380  Tryptophan metabolism
metd01100  Metabolic pathways
metd01110  Biosynthesis of secondary metabolites
metd01120  Microbial metabolism in diverse environments
metd01130  Biosynthesis of antibiotics
metd01200  Carbon metabolism
Module
metd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
metd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:metd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0214_09595
  09105 Amino acid metabolism
   00310 Lysine degradation
    C0214_09595
   00380 Tryptophan metabolism
    C0214_09595
Enzymes [BR:metd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     C0214_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AWI88479
UniProt: A0A2U8HR32
Position
complement(2015327..2016649)
Genome map
AA seq 440 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGQLGEIL
VKDGETVEPGAVLGSIVEGGKAAEKGASKPAPKSAEPAETKTQSREEKGEGKAAKEAPAQ
ESSASYGSHGDAPPAGGRGADESGPAVAKLARESGIDPASLNGSGKDGRVTKGDMLAAID
KGVPKAPAQEARTETKAPPRAPSAPDDAAREERVRMTKLRQTIARRLKSAQDTAAMLTTF
NDVDMGAVMALRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQDLVYKN
YYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKAREGKLSIDEMQGGTFTITN
GGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIVDGKEAV
TFLVRVKEALEDPARLVLDL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgatatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagccgctggtggaactcgag
accgacaaggtcacgctcgaggtgaacgctccggccgcgggccagctcggcgagatcctg
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgagggcggc
aaggctgccgagaagggcgcgagcaagccggccccgaagagcgccgagcccgccgagacc
aagacgcagagccgcgaggagaagggcgagggcaaggctgccaaggaggcgcccgcccag
gaatcctccgcctcctacggcagccacggcgacgccccgccggcggggggccgcggcgcc
gacgagagcggtccggcggtggccaagctcgcccgcgagtccggcatcgatcccgccagc
ctcaacggcagcggcaaggacggccgcgtgaccaagggcgacatgctcgccgccatcgac
aagggcgtcccgaaggctccggctcaggaggccaggaccgagaccaaggccccgccgcgg
gcgccgtccgcgccggacgacgccgcgcgcgaggagcgcgtgcggatgacgaagctgcgc
cagaccatcgcccggcgcctcaagagcgcccaggacacggcggcgatgctgaccacgttc
aacgacgtggacatgggcgcggtgatggcgctccgctcgcaatacaaggacattttcgag
aagaagcacgggacgaagctcggcttcatgggcttcttcaccaaggcggtgatcggcgcg
ctcaaggacgtgccggcggtcaatgccgagatcgacgggcaggacctcgtctacaagaac
tactaccacatcggcatcgcggtgggcaccgataagggcctggtcgtgccggtggtgcgc
gatgccgacgacctgtcgatcgccggcatcgagaagaagatcgccggcttcggcaagaag
gcgcgcgagggcaagctctccatcgacgagatgcagggcggcaccttcaccatcaccaac
ggcggcatctacggctcgctgatgtcgacgccgatcctcaacgccccgcaatcgggcatc
ctcggcatgcaccgcatcgaggagcgtccggtggtgcggaacggcaagatcgaggcgcgg
ccgatgatgtatctggcgctctcctacgatcaccgcatcgtcgacgggaaggaggccgtg
accttcctcgttcgcgtcaaggaggcgctggaggatccggcccgcctcgtgctcgacctc
tga

DBGET integrated database retrieval system