KEGG   Methylobacterium sp. DM1: C0214_12235Help
Entry
C0214_12235       CDS       T05461                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
metd  Methylobacterium sp. DM1
Pathway
metd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:metd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C0214_12235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:metd03011]
    C0214_12235
Ribosome [BR:metd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C0214_12235
  Bacteria
    C0214_12235
  Archaea
    C0214_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF3734
Motif
Other DBs
NCBI-ProteinID: AWI88956
UniProt: A0A2U8HVH8
Position
2573163..2573546
Genome map
AA seq 127 aa AA seqDB search
MGKPATPRALPENEAKAVARMLRVSPQKLNLVAALIRGKKVESALADLEFSRKRIARDVK
KCLESAIANAENNHDLDVDDLVVSQAFVGKALVLKRFHARARGRGARILKPFSNLTIVVR
EVRAEAA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcctgccaccccccgcgcgctccccgagaacgaggcgaaggccgtcgcgcgg
atgctccgcgtgtcgccccagaagctcaatctcgtggcggcgctgatccgcggcaagaag
gtcgagtcggcgctcgccgacctcgaattctcccgcaagcgcatcgcccgcgatgtgaag
aagtgcctcgagagcgcgatcgccaacgccgagaacaaccacgatctcgacgtggacgat
ctcgtcgtctcccaggctttcgtcggcaaggcgctggtgctcaagcgcttccacgcccgt
gcccgcggtcgcggcgcgcgcatcctgaagcccttctcgaacctcacgatcgtggttcgc
gaagtgcgcgctgaagcggcctga

DBGET integrated database retrieval system