KEGG   Methanothermobacter sp. EMTCatA1: tca_01113Help
Entry
tca_01113         CDS       T05328                                 

Definition
(GenBank) hypothetical protein
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mete  Methanothermobacter sp. EMTCatA1
Pathway
mete00680  Methane metabolism
mete01100  Metabolic pathways
mete01120  Microbial metabolism in diverse environments
mete01200  Carbon metabolism
Module
mete_M00357  Methanogenesis, acetate => methane
mete_M00567  Methanogenesis, CO2 => methane
mete_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mete00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    tca_01113
Enzymes [BR:mete01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     tca_01113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: BAZ99172
UniProt: A0A223ZFJ5
Position
complement(1040401..1041333)
Genome map
AA seq 310 aa AA seqDB search
MFRFDKEQIVLDIAGTKIGGQPGEYPTVLAGTIFYGGHSIIEDEKAGVFDKDKAEALIKT
QEEMSDVTGNPHIVQTFGQTPEAIVKYLEFVGDVTDAPFFIDSTSGEARIAGANYASEVG
LEDRAIYNSVNMAADEAELEALKETKLSASIVLGFNPMDPTVDGKIGIWEDGAGTIDKGL
LEMAAECGIDKYLMDVAVTPLGQGAGVAVRTSFAVKSKWGYPVGSGIHNVPSAWDWLREY
KKDHKEAWPVCDVGSNLIQQMAGGDFVLYGPIENAKMAFPACAMADIFISEAAKDIGTEP
VEDHPFFKLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggtttgataaggaacagatcgtactggatatagctggaaccaaaattggtggt
cagccaggagagtacccaactgttttagcaggaacaatattctatggtggacacagcatc
attgaggatgaaaaggccggtgtctttgacaaggacaaggcagaagccctcataaagacc
caggaagagatgtctgatgtcacaggtaacccgcacatcgtccagaccttcggtcagaca
ccagaagcaattgtcaagtacctcgaatttgtgggtgatgtgacagacgcaccattcttc
atagactcaacatccggtgaggcaaggatcgcaggtgctaactacgccagtgaagttgga
cttgaggacagggcaatctacaactcagtcaacatggccgctgatgaggcagaacttgag
gccctcaaggaaacaaaactctcagcttcaattgtcctcgggttcaacccaatggacccc
acagttgatggtaagattggaatctgggaagacggtgcaggcacaatagacaagggtctt
cttgaaatggctgccgagtgtggtatcgacaagtacctcatggacgtggctgtaacacca
ctcggtcagggtgccggtgtggctgtgaggacatcctttgcagtcaagagcaaatggggt
taccctgttggtagtggtatacacaacgtgccatcagcctgggactggctacgtgaatac
aagaaggaccacaaggaggcctggcctgtctgtgacgttggatccaacctgatccagcag
atggccggtggtgacttcgtcctctacggtccaatagaaaacgccaaaatggccttccct
gcctgtgcaatggctgacatattcataagtgaagcagccaaggacataggcacagaacca
gtggaagatcacccattcttcaaactgctctag

DBGET integrated database retrieval system