KEGG   Methanothermobacter sp. EMTCatA1: tca_01821Help
Entry
tca_01821         CDS       T05328                                 

Gene name
cysP
Definition
(GenBank) Sulfate permease CysP
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mete  Methanothermobacter sp. EMTCatA1
Brite
KEGG Orthology (KO) [BR:mete00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    tca_01821 (cysP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAZ99860
UniProt: A0A223ZIK2
Position
complement(1685522..1686499)
Genome map
AA seq 325 aa AA seqDB search
MDTLIAISLILSLYMAFNIAANDIGNSVGTAVGSGSLKMRRALILGAFFVSLGAILLGGN
VIKTISEGIIPQGFFSPRMALVVTATASIWITFTIIKKIPISGSDAIVSSVIGAGVAAVG
IQNMRLDVIGFIVLSWIISPLAGLLTGFLIYHAIRNMIIKALQGMGLRDRAEKIFSYFQI
VSSSFSALNLGAIDIAVAAGVIFAVGSFGGNWIRILGTIGLVAGILLAGNRVTETIGRRI
TDLTPSRGFSAQLAAAIIVYLFLGYGMPVSPTQTLVGSVIGVGIAHGTSTVKYDVIGHIA
YTWMVTIPTCIILSSAIYIITGFWG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacacactgatagcaataagtctcattctgagcctctacatggcattcaacattgct
gcaaatgacataggcaattcagtcggtacagccgtgggcagcggttccctcaagatgagg
agagctctcattctaggtgccttttttgtatccctgggagcaatattacttggcggaaac
gtcataaaaacaataagtgaaggaataatcccccagggatttttcagcccaaggatggcc
cttgtggtaaccgctacagcttcaatctggataacattcaccataatcaaaaagataccc
atttcaggatcagatgcaattgtaagctcagttattggcgccggggttgctgcagttggg
atccagaacatgcggctggatgtcattggattcatagtcctgagctggatcatatccccc
ctcgccggtcttttaacaggattcctgatataccatgctatcaggaatatgataataaaa
gcacttcagggtatgggactcagggatcgtgctgagaagattttttcctatttccagata
gtgagctcatcattctcagcccttaacctgggggccatagatatagctgttgccgcgggg
gttatattcgcagtgggaagtttcggaggaaactggatcagaatcctggggaccattggc
cttgttgcgggaatcctccttgcaggtaacagggttacagaaacaattgggagaagaata
acagatctaacaccaagcaggggcttttcagcccagctggcagctgcaattatagtttac
cttttcctgggttatggtatgccggtatcaccaacacagacactcgtaggatcagtgata
ggggtgggaattgcacatgggacatcaacagtcaaatatgatgttataggacacatagcc
tatacctggatggtcacgatacccacatgcatcatcctatcatctgcaatatacattatc
actggattctggggttaa

DBGET integrated database retrieval system