KEGG   Methanobacterium sp. MB1: MBMB1_0639Help
Entry
MBMB1_0639        CDS       T02957                                 

Definition
(GenBank) Digeranylgeranylglycerophospholipid reductase 1
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
meth  Methanobacterium sp. MB1
Pathway
meth00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:meth00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MBMB1_0639
Enzymes [BR:meth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     MBMB1_0639
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     MBMB1_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl DAO Trp_halogenase FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 NAD_binding_8 AlaDh_PNT_C Thi4 GIDA Pyr_redox NAD_binding_7 Pyr_redox_3 TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CDG64745
UniProt: U6EAB9
Position
complement(619142..620323)
Genome map
AA seq 393 aa AA seqDB search
MIETDVLVIGAGPAGSTAAKHAALGGAQVIIIDKKSEIGTPKRCAEGVSKEGLSKLGIEL
SPRWITREATGVRMVSPNGTAVNLTEDKVKLPEAGYILERKVFDKHMAMDAARAGAQIMV
KTLATGMRREGDEVVVTAENMGQELEIKAKIVIAADGPESRVGRWAGLKTSSAPKNMESC
AQFEMVGVEMAEPNCIEFHFGSAAPGGYAWIFPKGDDIANVGLGILTTRTDKTAYQHLLE
FVESNPATKNAQPVELNVGGDPVGGLLKKKVADNVLVTGDAASMVNPLTGGGIISGMLGG
RIAGQVAAQAVDDGDYSHKNLKVYDKLCEEELGESFKKYLKAKEYLLSLSDEELDEIADV
FKDSDFETINTKEMVRKLIKISPKALLKLGKLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaactgatgttctggttataggtgccgggcctgccggttcaactgcagctaaa
cacgctgccctaggtggtgcccaagtaataatcattgataaaaaatcagagataggaacc
cctaaaagatgcgcagaaggagtttctaaagaaggacttagtaaactgggaatcgaatta
tccccccgatggataacccgcgaagccaccggtgtgcgaatggtctccccaaacggcacc
gctgtcaacttaaccgaagataaagttaaactcccagaagcagggtacatcctggaacgt
aaagtctttgacaaacacatggccatggatgctgcccgtgccggggcccagataatggtc
aaaaccctggccactggtatgcggagggaaggtgatgaggtagtagttactgccgagaac
atgggccaagaattggagatcaaagccaagatcgtaattgcagctgatggtccagaatcc
cgggtgggaagatgggccgggctaaaaacatcctcagcccctaaaaatatggaatcctgt
gcccagtttgaaatggtaggagtcgaaatggcagaaccaaactgtatagaattccatttc
ggtagtgcagcccctggtggttatgcttggatattccccaagggcgatgacatagccaat
gtaggcctgggtattttaaccactagaactgacaaaaccgcctaccaacacctcttagag
tttgtggaaagtaatcctgctactaaaaatgctcaaccagtagaacttaatgtaggagga
gatccggtaggtggtctactgaagaaaaaagtagcagacaatgtcctggtaaccggggat
gcagccagtatggttaaccccctcactggtggaggtataattagtggtatgctaggaggc
cgtatcgctggtcaggtagctgcccaagctgtggatgatggagattattcccataaaaac
cttaaagtgtatgataaactctgtgaagaggaactgggagaatcattcaaaaaatacttg
aaggccaaagaatatcttttaagtctttctgatgaagaactggatgaaatcgctgatgtc
ttcaaggacagtgattttgaaaccattaacaccaaagaaatggttagaaaactaattaag
atttcaccaaaggcccttttaaaactgggtaaactgttctaa

DBGET integrated database retrieval system